BLASTX nr result
ID: Coptis25_contig00034273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034273 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004134263.1| PREDICTED: uncharacterized protein LOC101217... 55 5e-06 >ref|XP_004134263.1| PREDICTED: uncharacterized protein LOC101217008 [Cucumis sativus] Length = 1163 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/68 (38%), Positives = 41/68 (60%) Frame = -2 Query: 207 GDIMAEGVWLSDNPNIVVQGKKLGSGASKIEVKFVNDPKAKLWRPSNGMKTFEDALGYSI 28 G+++AEG W S++P ++V LG A K+ V A LWRP++ M +DA+G ++ Sbjct: 1090 GEVVAEGRWSSNDPKVIVHHVPLGPQAVKVWVDLPKRSDAFLWRPNSEMHYIKDAVGSAV 1149 Query: 27 ALPTDHVI 4 A P D V+ Sbjct: 1150 AWPLDKVV 1157