BLASTX nr result
ID: Coptis25_contig00034165
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034165 (275 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156728.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 ref|XP_004142850.1| PREDICTED: pentatricopeptide repeat-containi... 72 5e-11 ref|XP_002324003.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 ref|XP_002521455.1| pentatricopeptide repeat-containing protein,... 60 2e-07 emb|CBI15512.3| unnamed protein product [Vitis vinifera] 58 9e-07 >ref|XP_004156728.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Cucumis sativus] Length = 636 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/58 (53%), Positives = 46/58 (79%) Frame = -2 Query: 175 TLDLYKVLINSLCKLHRSVEGECMMKELVGANLVPDYDICKALVNGYCKERSFHNAES 2 T D YK LI+ +C+++RSV+GE +M E+V + ++PD++IC+ALVNGYCKE + AES Sbjct: 504 TTDTYKSLIHCMCEINRSVDGEGLMVEMVESEVIPDHEICRALVNGYCKEGNADKAES 561 >ref|XP_004142850.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Cucumis sativus] Length = 632 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/58 (53%), Positives = 46/58 (79%) Frame = -2 Query: 175 TLDLYKVLINSLCKLHRSVEGECMMKELVGANLVPDYDICKALVNGYCKERSFHNAES 2 T D YK LI+ +C+++RSV+GE +M E+V + ++PD++IC+ALVNGYCKE + AES Sbjct: 500 TTDTYKSLIHCMCEINRSVDGEGLMVEMVESEVIPDHEICRALVNGYCKEGNADKAES 557 >ref|XP_002324003.1| predicted protein [Populus trichocarpa] gi|222867005|gb|EEF04136.1| predicted protein [Populus trichocarpa] Length = 626 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/54 (46%), Positives = 39/54 (72%) Frame = -2 Query: 163 YKVLINSLCKLHRSVEGECMMKELVGANLVPDYDICKALVNGYCKERSFHNAES 2 YK LI LC++ RS+E E +M+E++ L PD +IC+A+++GYC+E+ AES Sbjct: 500 YKALIRCLCRMGRSIEAEKLMEEMLHFGLQPDPEICRAMIHGYCREKDAGKAES 553 >ref|XP_002521455.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539354|gb|EEF40945.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 623 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/54 (48%), Positives = 39/54 (72%) Frame = -2 Query: 163 YKVLINSLCKLHRSVEGECMMKELVGANLVPDYDICKALVNGYCKERSFHNAES 2 YK LI LC+ RS+E E +M+E++ + ++PD DIC+AL++ YCKER AE+ Sbjct: 497 YKALICCLCRTSRSMEAESLMEEMLQSGMLPDPDICRALMHVYCKERDIGKAET 550 >emb|CBI15512.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/57 (43%), Positives = 38/57 (66%) Frame = -2 Query: 172 LDLYKVLINSLCKLHRSVEGECMMKELVGANLVPDYDICKALVNGYCKERSFHNAES 2 L Y+ +I L +L RS+EGE ++ E+V + ++PD +IC+AL GYC+E AES Sbjct: 503 LATYRAVIGCLSRLSRSMEGESLVGEMVASGMLPDLEICRALFYGYCRENDIDKAES 559