BLASTX nr result
ID: Coptis25_contig00034129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00034129 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19162.3| unnamed protein product [Vitis vinifera] 55 6e-06 >emb|CBI19162.3| unnamed protein product [Vitis vinifera] Length = 691 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = +1 Query: 1 EENGLGSSSTYLQTHPQSHQLFSWRWLSQAGYQ 99 EENG+G+SS+YLQ HP+SHQL +W+ LSQ GY+ Sbjct: 651 EENGIGTSSSYLQRHPRSHQLMNWKQLSQTGYK 683