BLASTX nr result
ID: Coptis25_contig00033877
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033877 (614 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516959.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002516959.1| conserved hypothetical protein [Ricinus communis] gi|223544047|gb|EEF45573.1| conserved hypothetical protein [Ricinus communis] Length = 667 Score = 56.2 bits (134), Expect = 4e-06 Identities = 38/99 (38%), Positives = 55/99 (55%), Gaps = 3/99 (3%) Frame = +2 Query: 2 YVRLLSHVKRPEERKFG-SRKRVKSPLGKHRSQGNKDKIIXXXXXXXXXXXXXXXXXXXX 178 +++LL+H KR ++ +F S+KRVKSPL + ++G+ DK Sbjct: 578 HIQLLNHDKRRKDLQFRLSKKRVKSPLRRGCNKGSGDK-----------SGKETSPSINS 626 Query: 179 XXGSGDLCVKLGKT--IRCTPEGKRRRRSRLVEAVDMQS 289 +G+ VKLGK RCTPE K+RRR+R VE VD+ S Sbjct: 627 SQLNGNFTVKLGKIGGARCTPESKKRRRARFVEPVDIHS 665