BLASTX nr result
ID: Coptis25_contig00033774
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033774 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM63025.1| unknown [Arabidopsis thaliana] 57 2e-06 ref|NP_198883.1| cystinosin [Arabidopsis thaliana] gi|13124057|s... 56 3e-06 >gb|AAM63025.1| unknown [Arabidopsis thaliana] Length = 270 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -1 Query: 299 NIS*TDLLQVSIFFDLLFIVQHYFLYPSKKEKVSPEADEESTAPLVKFPH 150 N+ T L +SIFFD+LF+ QHY LYP KK SPE EES PL+ H Sbjct: 218 NMGKTLLSLISIFFDILFMCQHYVLYPEKKVSKSPETSEESNEPLIDSSH 267 >ref|NP_198883.1| cystinosin [Arabidopsis thaliana] gi|13124057|sp|P57758.1|CTNS_ARATH RecName: Full=Cystinosin homolog gi|9758095|dbj|BAB08539.1| unnamed protein product [Arabidopsis thaliana] gi|15529266|gb|AAK97727.1| AT5g40670/MNF13_190 [Arabidopsis thaliana] gi|16974419|gb|AAL31135.1| AT5g40670/MNF13_190 [Arabidopsis thaliana] gi|332007197|gb|AED94580.1| cystinosin [Arabidopsis thaliana] Length = 270 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/50 (54%), Positives = 32/50 (64%) Frame = -1 Query: 299 NIS*TDLLQVSIFFDLLFIVQHYFLYPSKKEKVSPEADEESTAPLVKFPH 150 N+ T L +SIFFD+LF+ QHY LYP KK SPE EES PL+ H Sbjct: 218 NMGKTLLSLISIFFDILFMFQHYVLYPEKKVSKSPETGEESNEPLIDSSH 267