BLASTX nr result
ID: Coptis25_contig00033741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033741 (930 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515302.1| DNA replication regulator dpb11, putative [R... 63 1e-07 ref|XP_002874938.1| predicted protein [Arabidopsis lyrata subsp.... 59 2e-06 ref|NP_192120.4| transcription coactivator protein [Arabidopsis ... 59 2e-06 gb|AAC78713.1| predicted protein of unknown function [Arabidopsi... 59 2e-06 ref|XP_002320980.1| predicted protein [Populus trichocarpa] gi|2... 58 4e-06 >ref|XP_002515302.1| DNA replication regulator dpb11, putative [Ricinus communis] gi|223545782|gb|EEF47286.1| DNA replication regulator dpb11, putative [Ricinus communis] Length = 1069 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +1 Query: 1 KKIRLVNHSWLEDCLRTWEILPECDYNKSGYEL 99 KKI+LVNH WLEDCLR WE+LPE +Y+KSGYEL Sbjct: 165 KKIKLVNHRWLEDCLRDWELLPEDNYSKSGYEL 197 >ref|XP_002874938.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297320775|gb|EFH51197.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 1313 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 KKIRLVNHSWLEDCLRTWEILPECDYNKSGYEL 99 K+I+LVNH WLEDCL+ W++LPE DY SGYEL Sbjct: 121 KRIKLVNHRWLEDCLKNWKLLPEVDYEISGYEL 153 >ref|NP_192120.4| transcription coactivator protein [Arabidopsis thaliana] gi|363548502|sp|O04251.3|Y4211_ARATH RecName: Full=BRCT domain-containing protein At4g02110 gi|332656725|gb|AEE82125.1| transcription coactivator protein [Arabidopsis thaliana] Length = 1329 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 KKIRLVNHSWLEDCLRTWEILPECDYNKSGYEL 99 K+I+LVNH WLEDCL+ W++LPE DY SGYEL Sbjct: 167 KRIKLVNHRWLEDCLKNWKLLPEVDYEISGYEL 199 >gb|AAC78713.1| predicted protein of unknown function [Arabidopsis thaliana] gi|7268595|emb|CAB80704.1| predicted protein of unknown function [Arabidopsis thaliana] Length = 1293 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +1 Query: 1 KKIRLVNHSWLEDCLRTWEILPECDYNKSGYEL 99 K+I+LVNH WLEDCL+ W++LPE DY SGYEL Sbjct: 131 KRIKLVNHRWLEDCLKNWKLLPEVDYEISGYEL 163 >ref|XP_002320980.1| predicted protein [Populus trichocarpa] gi|222861753|gb|EEE99295.1| predicted protein [Populus trichocarpa] Length = 1282 Score = 57.8 bits (138), Expect = 4e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +1 Query: 1 KKIRLVNHSWLEDCLRTWEILPECDYNKSGYEL 99 KKI+LVNH WLE+ LR WE+LPE +Y+KSGYEL Sbjct: 208 KKIKLVNHRWLEESLRNWELLPEDNYSKSGYEL 240