BLASTX nr result
ID: Coptis25_contig00033563
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033563 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633574.1| PREDICTED: protein gamma response 1-like [Vi... 57 2e-06 emb|CBI24861.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_003633574.1| PREDICTED: protein gamma response 1-like [Vitis vinifera] Length = 640 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 296 FLDTPIENTRGNLNKAQNEEVHDCPAPAPKDMNVDN 189 FLDTP+EN +GNLNKA+ EE HD P PKDMN D+ Sbjct: 497 FLDTPLENIKGNLNKAKKEEYHDLPVAIPKDMNFDS 532 >emb|CBI24861.3| unnamed protein product [Vitis vinifera] Length = 645 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 296 FLDTPIENTRGNLNKAQNEEVHDCPAPAPKDMNVDN 189 FLDTP+EN +GNLNKA+ EE HD P PKDMN D+ Sbjct: 502 FLDTPLENIKGNLNKAKKEEYHDLPVAIPKDMNFDS 537