BLASTX nr result
ID: Coptis25_contig00033501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033501 (413 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270274.1| PREDICTED: ribosomal RNA small subunit methy... 79 5e-13 ref|XP_002511789.1| dimethyladenosine transferase, putative [Ric... 77 2e-12 ref|XP_003552364.1| PREDICTED: ribosomal RNA small subunit methy... 70 2e-10 ref|XP_003534590.1| PREDICTED: ribosomal RNA small subunit methy... 70 2e-10 ref|XP_002889349.1| hypothetical protein ARALYDRAFT_470090 [Arab... 69 3e-10 >ref|XP_002270274.1| PREDICTED: ribosomal RNA small subunit methyltransferase A [Vitis vinifera] gi|296089082|emb|CBI38785.3| unnamed protein product [Vitis vinifera] Length = 335 Score = 78.6 bits (192), Expect = 5e-13 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = -3 Query: 411 SLQHICTAPEIEEALGNVGVPVTSRPEELTLDDFVRLHNLIVK 283 SLQHICT+ EIEEAL NVG+P TSRPEELTLDDFVRLHNLIVK Sbjct: 292 SLQHICTSIEIEEALRNVGLPATSRPEELTLDDFVRLHNLIVK 334 >ref|XP_002511789.1| dimethyladenosine transferase, putative [Ricinus communis] gi|223548969|gb|EEF50458.1| dimethyladenosine transferase, putative [Ricinus communis] Length = 338 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/43 (81%), Positives = 40/43 (93%) Frame = -3 Query: 411 SLQHICTAPEIEEALGNVGVPVTSRPEELTLDDFVRLHNLIVK 283 SLQHICT+PEIE+AL NVG+P TSRPEELTLDDFV+LHNLI + Sbjct: 295 SLQHICTSPEIEQALINVGLPATSRPEELTLDDFVKLHNLIAR 337 >ref|XP_003552364.1| PREDICTED: ribosomal RNA small subunit methyltransferase A-like [Glycine max] Length = 341 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 411 SLQHICTAPEIEEALGNVGVPVTSRPEELTLDDFVRLHNLIVK 283 SLQHICT+ EIEEAL ++G+ TSRPEELTLDDFV+LHNLI K Sbjct: 298 SLQHICTSLEIEEALTSIGLLATSRPEELTLDDFVKLHNLIAK 340 >ref|XP_003534590.1| PREDICTED: ribosomal RNA small subunit methyltransferase A-like [Glycine max] Length = 341 Score = 69.7 bits (169), Expect = 2e-10 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -3 Query: 411 SLQHICTAPEIEEALGNVGVPVTSRPEELTLDDFVRLHNLIVK 283 SLQHICT+ EIEEAL ++G+ TSRPEELTLDDFV+LHNLI K Sbjct: 298 SLQHICTSLEIEEALTSIGLLATSRPEELTLDDFVKLHNLIAK 340 >ref|XP_002889349.1| hypothetical protein ARALYDRAFT_470090 [Arabidopsis lyrata subsp. lyrata] gi|297335191|gb|EFH65608.1| hypothetical protein ARALYDRAFT_470090 [Arabidopsis lyrata subsp. lyrata] Length = 342 Score = 69.3 bits (168), Expect = 3e-10 Identities = 32/41 (78%), Positives = 38/41 (92%) Frame = -3 Query: 411 SLQHICTAPEIEEALGNVGVPVTSRPEELTLDDFVRLHNLI 289 SLQHI ++PEIE+ALG G+PVTSRPEELTLDDFV+LHN+I Sbjct: 299 SLQHISSSPEIEKALGVAGLPVTSRPEELTLDDFVKLHNVI 339