BLASTX nr result
ID: Coptis25_contig00033282
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033282 (786 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535452.1| conserved hypothetical protein [Ricinus comm... 82 2e-13 ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medica... 59 5e-10 >ref|XP_002535452.1| conserved hypothetical protein [Ricinus communis] gi|223523063|gb|EEF26931.1| conserved hypothetical protein [Ricinus communis] Length = 55 Score = 81.6 bits (200), Expect = 2e-13 Identities = 39/43 (90%), Positives = 39/43 (90%) Frame = -1 Query: 786 SFFGSTKRELA*KWDRGQDAAGRRRLTQVPPEPREMVAYYTAH 658 SFFGSTK ELA KWDRGQDA GRRRLTQVP EPREMVAYYTAH Sbjct: 13 SFFGSTKGELAQKWDRGQDAVGRRRLTQVPLEPREMVAYYTAH 55 >ref|XP_003588347.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] gi|355477395|gb|AES58598.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula] Length = 339 Score = 58.5 bits (140), Expect(2) = 5e-10 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 637 PPPQAELVSRVIGDHFARFGGHLSQPP 717 P PQAELVSRVIGDHFARFGGHLSQPP Sbjct: 54 PTPQAELVSRVIGDHFARFGGHLSQPP 80 Score = 31.6 bits (70), Expect(2) = 5e-10 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 609 APDRRRIIGTPTP 647 APDRRRIIGTPTP Sbjct: 44 APDRRRIIGTPTP 56