BLASTX nr result
ID: Coptis25_contig00033278
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033278 (675 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252... 128 1e-27 ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219... 127 2e-27 ref|XP_004161098.1| PREDICTED: uncharacterized protein LOC101226... 123 3e-26 ref|XP_004143080.1| PREDICTED: uncharacterized protein LOC101214... 123 3e-26 ref|XP_002526725.1| conserved hypothetical protein [Ricinus comm... 119 7e-25 >ref|XP_002271842.1| PREDICTED: uncharacterized protein LOC100252260 [Vitis vinifera] Length = 365 Score = 128 bits (321), Expect = 1e-27 Identities = 60/115 (52%), Positives = 85/115 (73%) Frame = +2 Query: 2 YKSFGWSEDEVLAVFNKQPFIMGASLKKISTALDFFMNNLNWSRDDISKYATVLLLSMEK 181 ++SFGW E+E +A+F KQP M S +I LDF +N LNW +DI KY VLLLS+EK Sbjct: 244 FRSFGWGEEEFIALFVKQPQFMSNSETRIRKCLDFLINELNWMPEDIFKYPMVLLLSLEK 303 Query: 182 RIVPRSFVLQILLSKGLIRKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQS 346 R+VPRS VLQ+L+ KGL+ + S+GRAL + E+ F++ F+ Y+ ++PELL++YQS Sbjct: 304 RVVPRSRVLQLLIGKGLVTRRSIGRALIISEDRFMKVFMSSYEKKIPELLEVYQS 358 >ref|XP_004138819.1| PREDICTED: uncharacterized protein LOC101219073 [Cucumis sativus] Length = 382 Score = 127 bits (320), Expect = 2e-27 Identities = 58/116 (50%), Positives = 89/116 (76%) Frame = +2 Query: 2 YKSFGWSEDEVLAVFNKQPFIMGASLKKISTALDFFMNNLNWSRDDISKYATVLLLSMEK 181 ++S+GWS+++ ++F KQP M S + + ALDFFMN +W+R++I +Y VL+LS EK Sbjct: 262 FRSYGWSDEQFQSMFLKQPCFMNRSEEGLKRALDFFMNKWDWTREEIYRYPIVLILSFEK 321 Query: 182 RIVPRSFVLQILLSKGLIRKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQSK 349 R++PRS +LQ L+SKGLI++ S+G ALK+ E+ FLE+FV++Y +E P LL++YQ K Sbjct: 322 RVMPRSSILQHLISKGLIKRKSLGMALKISEHEFLEKFVMQYLSEDPHLLEMYQEK 377 >ref|XP_004161098.1| PREDICTED: uncharacterized protein LOC101226818 [Cucumis sativus] Length = 402 Score = 123 bits (309), Expect = 3e-26 Identities = 56/116 (48%), Positives = 88/116 (75%) Frame = +2 Query: 2 YKSFGWSEDEVLAVFNKQPFIMGASLKKISTALDFFMNNLNWSRDDISKYATVLLLSMEK 181 ++SFGWS+++ ++F K+PF+M +S + + ALDFF+ +W+ +DISKY+ +L S+EK Sbjct: 262 FRSFGWSDEQFQSMFLKKPFVMNSSEEHLKRALDFFVIKWDWTWEDISKYSLLLNFSLEK 321 Query: 182 RIVPRSFVLQILLSKGLIRKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQSK 349 R++PRS +LQ L+SKG I++ SVG AL E+ FLE+FV++Y +E P LL++YQ K Sbjct: 322 RLIPRSSILQHLISKGFIKRKSVGSALNSPEHKFLEKFVMKYLSEDPNLLEMYQEK 377 >ref|XP_004143080.1| PREDICTED: uncharacterized protein LOC101214641 [Cucumis sativus] Length = 402 Score = 123 bits (309), Expect = 3e-26 Identities = 56/116 (48%), Positives = 88/116 (75%) Frame = +2 Query: 2 YKSFGWSEDEVLAVFNKQPFIMGASLKKISTALDFFMNNLNWSRDDISKYATVLLLSMEK 181 ++SFGWS+++ ++F K+PF+M +S + + ALDFF+ +W+ +DISKY+ +L S+EK Sbjct: 262 FRSFGWSDEQFQSMFLKKPFVMNSSEEHLKRALDFFVIKWDWTWEDISKYSLLLNFSLEK 321 Query: 182 RIVPRSFVLQILLSKGLIRKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQSK 349 R++PRS +LQ L+SKG I++ SVG AL E+ FLE+FV++Y +E P LL++YQ K Sbjct: 322 RLIPRSSILQHLISKGFIKRKSVGSALNSPEHKFLEKFVMKYLSEDPNLLEMYQEK 377 >ref|XP_002526725.1| conserved hypothetical protein [Ricinus communis] gi|223533914|gb|EEF35639.1| conserved hypothetical protein [Ricinus communis] Length = 441 Score = 119 bits (297), Expect = 7e-25 Identities = 53/118 (44%), Positives = 82/118 (69%) Frame = +2 Query: 2 YKSFGWSEDEVLAVFNKQPFIMGASLKKISTALDFFMNNLNWSRDDISKYATVLLLSMEK 181 YK +GWS++E L VF K P++M S KKI +D+++N + W I+K+ ++ LS+EK Sbjct: 316 YKKWGWSQEETLVVFGKFPWVMMYSEKKIMKMMDYYINKMGWDSSSIAKHPLLISLSLEK 375 Query: 182 RIVPRSFVLQILLSKGLIRKNSVGRALKLVENAFLERFVIRYQNEVPELLKLYQSKVS 355 R++PR V+Q+LLSKGL+R S+ +L++ E FL +FV Y+ E P LLKLYQ +++ Sbjct: 376 RVIPRCSVIQVLLSKGLVRLTSLATSLRISEELFLHKFVRPYKEEAPHLLKLYQEELN 433