BLASTX nr result
ID: Coptis25_contig00033217
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033217 (405 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532277.1| conserved hypothetical protein [Ricinus comm... 58 9e-07 >ref|XP_002532277.1| conserved hypothetical protein [Ricinus communis] gi|223528011|gb|EEF30092.1| conserved hypothetical protein [Ricinus communis] Length = 410 Score = 57.8 bits (138), Expect = 9e-07 Identities = 42/140 (30%), Positives = 65/140 (46%), Gaps = 7/140 (5%) Frame = -2 Query: 404 WCNAICHPSFAKMQ*VHALQNRSPCVVILNGEDLGFVSEQFRTTAYSLRYIESV------ 243 W + + HP A M N PC+++L + +A IE+V Sbjct: 53 WRSLVQHPLLASMHFSRIANNNDPCLLLLCDLPIKSHLYSLHFSALDETIIETVTRIPVP 112 Query: 242 LTSSFRLLGSVNGLLCLTSVSLFYHPFYYIFNPISKEEISLSESPRYCS-HSVGSGFGFD 66 + F ++GS NGLL L + YI+NP + + + L E + + H V +GFGF Sbjct: 113 VIPKFLVIGSCNGLLYL--LDSLQQRANYIYNPFTSDYLELPEPGQVLNQHRVATGFGFH 170 Query: 65 LTDDKYKVVRILHAVQHKNN 6 T +YKVVR+ V ++NN Sbjct: 171 STTKEYKVVRV---VYYRNN 187