BLASTX nr result
ID: Coptis25_contig00032981
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032981 (287 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADV78061.1| DMI1 [Cercis canadensis] 56 4e-06 >gb|ADV78061.1| DMI1 [Cercis canadensis] Length = 596 Score = 55.8 bits (133), Expect = 4e-06 Identities = 37/76 (48%), Positives = 46/76 (60%), Gaps = 3/76 (3%) Frame = +3 Query: 9 ETF*DEGNGTTEGSLLNELAIANKSLGRGTVLAMAEQGKEEWNLT*PTPKEHVSYIECS- 185 E F G +EGSLLN+LAIAN+SLG GTV+ MAE+ KEE L K + S Sbjct: 76 EKFDSLRKGKSEGSLLNQLAIANESLGGGTVVVMAERDKEEMEL--DIAKMEFDFKGTSV 133 Query: 186 --KSGIPLILYEPKKI 227 +SG PLIL + KK+ Sbjct: 134 ICRSGSPLILADLKKV 149