BLASTX nr result
ID: Coptis25_contig00032765
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032765 (209 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003609372.1| WD repeat-containing protein [Medicago trunc... 99 4e-19 ref|XP_002325208.1| predicted protein [Populus trichocarpa] gi|2... 99 4e-19 ref|XP_003541474.1| PREDICTED: WD repeat-containing protein 11-l... 99 5e-19 ref|XP_002527186.1| nucleotide binding protein, putative [Ricinu... 98 8e-19 ref|XP_004166124.1| PREDICTED: WD repeat-containing protein 11-l... 96 2e-18 >ref|XP_003609372.1| WD repeat-containing protein [Medicago truncatula] gi|355510427|gb|AES91569.1| WD repeat-containing protein [Medicago truncatula] Length = 1581 Score = 99.0 bits (245), Expect = 4e-19 Identities = 48/54 (88%), Positives = 49/54 (90%) Frame = -2 Query: 208 EELWGSASERIPWHEKLEGEEAIQNRVHELVSVGNLEDAVTLLLSTPPEGSYFY 47 EELW SASERI WHEKLEGEEAIQ RVHELVSVGNLE AV+LLLSTPPE SYFY Sbjct: 1243 EELWKSASERISWHEKLEGEEAIQKRVHELVSVGNLEAAVSLLLSTPPESSYFY 1296 >ref|XP_002325208.1| predicted protein [Populus trichocarpa] gi|222866642|gb|EEF03773.1| predicted protein [Populus trichocarpa] Length = 1311 Score = 99.0 bits (245), Expect = 4e-19 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 208 EELWGSASERIPWHEKLEGEEAIQNRVHELVSVGNLEDAVTLLLSTPPEGSYFY 47 EELW SA ERIPWHEKLEGEEAIQNRVHELVS+GNLE AV+LLLST PE SYFY Sbjct: 1062 EELWESACERIPWHEKLEGEEAIQNRVHELVSIGNLEAAVSLLLSTSPESSYFY 1115 >ref|XP_003541474.1| PREDICTED: WD repeat-containing protein 11-like [Glycine max] Length = 1252 Score = 98.6 bits (244), Expect = 5e-19 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 208 EELWGSASERIPWHEKLEGEEAIQNRVHELVSVGNLEDAVTLLLSTPPEGSYFY 47 EELW SASERI WHEKLEGEEAIQ R+HELVSVGNLE AV+LLLSTPPE SYFY Sbjct: 1024 EELWKSASERISWHEKLEGEEAIQKRIHELVSVGNLEAAVSLLLSTPPESSYFY 1077 >ref|XP_002527186.1| nucleotide binding protein, putative [Ricinus communis] gi|223533451|gb|EEF35199.1| nucleotide binding protein, putative [Ricinus communis] Length = 1357 Score = 97.8 bits (242), Expect = 8e-19 Identities = 46/54 (85%), Positives = 50/54 (92%) Frame = -2 Query: 208 EELWGSASERIPWHEKLEGEEAIQNRVHELVSVGNLEDAVTLLLSTPPEGSYFY 47 EELW +A+ERIPWHEKLEGEEAIQNRVHELVSVGNLE AV+LLLST P+ SYFY Sbjct: 1109 EELWENANERIPWHEKLEGEEAIQNRVHELVSVGNLEAAVSLLLSTSPDSSYFY 1162 >ref|XP_004166124.1| PREDICTED: WD repeat-containing protein 11-like, partial [Cucumis sativus] Length = 844 Score = 96.3 bits (238), Expect = 2e-18 Identities = 45/54 (83%), Positives = 49/54 (90%) Frame = -2 Query: 208 EELWGSASERIPWHEKLEGEEAIQNRVHELVSVGNLEDAVTLLLSTPPEGSYFY 47 EELW SA+ERIPWHE+L+GEE IQNRVHELVSVGNLE AV+LLLST PE SYFY Sbjct: 594 EELWESANERIPWHERLDGEEVIQNRVHELVSVGNLEAAVSLLLSTSPESSYFY 647