BLASTX nr result
ID: Coptis25_contig00032674
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032674 (571 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36608.1| BZIP domain class transcription factor [Malus x d... 65 6e-09 gb|ADL36607.1| BZIP domain class transcription factor [Malus x d... 64 1e-08 gb|ADL36603.1| BZIP domain class transcription factor [Malus x d... 64 1e-08 ref|XP_002264896.1| PREDICTED: root phototropism protein 2 [Viti... 64 2e-08 emb|CBI15801.3| unnamed protein product [Vitis vinifera] 62 7e-08 >gb|ADL36608.1| BZIP domain class transcription factor [Malus x domestica] Length = 577 Score = 65.5 bits (158), Expect = 6e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -2 Query: 570 AMERTGQWIFSQDIPSDVVVEVGEANFSLHK 478 AMERTGQWIFSQDIPSDVVV+VGEANFSLHK Sbjct: 14 AMERTGQWIFSQDIPSDVVVQVGEANFSLHK 44 >gb|ADL36607.1| BZIP domain class transcription factor [Malus x domestica] Length = 577 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 570 AMERTGQWIFSQDIPSDVVVEVGEANFSLHK 478 AMERTGQWI SQDIPSDVVVEVGEANFSLHK Sbjct: 14 AMERTGQWIISQDIPSDVVVEVGEANFSLHK 44 >gb|ADL36603.1| BZIP domain class transcription factor [Malus x domestica] Length = 577 Score = 64.3 bits (155), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -2 Query: 570 AMERTGQWIFSQDIPSDVVVEVGEANFSLHK 478 AMERTGQWI SQDIPSDVVVEVGEANFSLHK Sbjct: 14 AMERTGQWIISQDIPSDVVVEVGEANFSLHK 44 >ref|XP_002264896.1| PREDICTED: root phototropism protein 2 [Vitis vinifera] Length = 572 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 570 AMERTGQWIFSQDIPSDVVVEVGEANFSLHK 478 AMERTGQW+FSQ+IP+DVVVEVGEANFSLHK Sbjct: 14 AMERTGQWVFSQEIPTDVVVEVGEANFSLHK 44 >emb|CBI15801.3| unnamed protein product [Vitis vinifera] Length = 191 Score = 62.0 bits (149), Expect = 7e-08 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 567 MERTGQWIFSQDIPSDVVVEVGEANFSLHK 478 MERTGQW+FSQ+IP+DVVVEVGEANFSLHK Sbjct: 1 MERTGQWVFSQEIPTDVVVEVGEANFSLHK 30