BLASTX nr result
ID: Coptis25_contig00032588
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032588 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis... 70 2e-10 ref|XP_003517411.1| PREDICTED: peroxisomal acyl-coenzyme A oxida... 67 2e-09 ref|NP_181112.1| acyl-CoA oxidase [Arabidopsis thaliana] gi|6228... 67 2e-09 ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata ... 66 3e-09 ref|XP_002326656.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 >ref|XP_002525341.1| acyl-CoA oxidase, putative [Ricinus communis] gi|223535400|gb|EEF37074.1| acyl-CoA oxidase, putative [Ricinus communis] Length = 664 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = +2 Query: 107 VDHLADERNKAQFDVDAMKIVWAGSQHDFNVIDRMSRLV 223 VDHLA+ERNKAQFDVD MKIVWAGS+H F+V DRM+RLV Sbjct: 4 VDHLAEERNKAQFDVDEMKIVWAGSRHAFDVADRMARLV 42 >ref|XP_003517411.1| PREDICTED: peroxisomal acyl-coenzyme A oxidase 1-like [Glycine max] Length = 665 Score = 67.0 bits (162), Expect = 2e-09 Identities = 32/43 (74%), Positives = 36/43 (83%) Frame = +2 Query: 95 MEVVVDHLADERNKAQFDVDAMKIVWAGSQHDFNVIDRMSRLV 223 ME +DHLA ERNKAQFDVD MKIVWAGS+ DF + DR+SRLV Sbjct: 1 MEDSIDHLAFERNKAQFDVDEMKIVWAGSRQDFELSDRISRLV 43 >ref|NP_181112.1| acyl-CoA oxidase [Arabidopsis thaliana] gi|62286640|sp|Q9ZQP2.1|ACO12_ARATH RecName: Full=Putative peroxisomal acyl-coenzyme A oxidase 1.2 gi|4263786|gb|AAD15446.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|18377807|gb|AAL67053.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|20465713|gb|AAM20325.1| putative acyl-CoA oxidase [Arabidopsis thaliana] gi|330254051|gb|AEC09145.1| acyl-CoA oxidase [Arabidopsis thaliana] Length = 664 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = +2 Query: 107 VDHLADERNKAQFDVDAMKIVWAGSQHDFNVIDRMSRLV 223 VDHLADERNKA+F+VD MKIVWAGS+H F+V +RMSRLV Sbjct: 4 VDHLADERNKAEFNVDDMKIVWAGSRHAFDVSNRMSRLV 42 >ref|XP_002868103.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] gi|297313939|gb|EFH44362.1| Acyl-coenzyme A oxidase [Arabidopsis lyrata subsp. lyrata] Length = 664 Score = 66.2 bits (160), Expect = 3e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 107 VDHLADERNKAQFDVDAMKIVWAGSQHDFNVIDRMSRLV 223 VDHLADERNKA+FDV+ MKIVWAGS+H F V DR++RLV Sbjct: 4 VDHLADERNKAEFDVEEMKIVWAGSRHAFEVSDRIARLV 42 >ref|XP_002326656.1| predicted protein [Populus trichocarpa] gi|222833978|gb|EEE72455.1| predicted protein [Populus trichocarpa] Length = 664 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 107 VDHLADERNKAQFDVDAMKIVWAGSQHDFNVIDRMSRLV 223 VDHLA ERNK +FDVDAMKIVWAGS+H F + DRM+RLV Sbjct: 4 VDHLAHERNKTEFDVDAMKIVWAGSRHAFELSDRMARLV 42