BLASTX nr result
ID: Coptis25_contig00032577
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032577 (373 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago trunc... 84 1e-14 ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago ... 82 4e-14 ref|XP_003615119.1| Zinc finger MYM-type protein [Medicago trunc... 75 4e-12 gb|AAF82236.1|AC069143_12 Contains similarity to a transposable ... 75 6e-12 ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerizat... 75 6e-12 >ref|XP_003615596.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516931|gb|AES98554.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 892 Score = 84.0 bits (206), Expect = 1e-14 Identities = 45/95 (47%), Positives = 54/95 (56%), Gaps = 2/95 (2%) Frame = -1 Query: 280 KRSHQETEDGGVEQPTSKRVQREELDLSSIQGDPALRKKISDYHPNDQDSVRRAYLLRGP 101 KRS E G Q S +L + DP R K+S YHPNDQ+ +RRAYL +GP Sbjct: 119 KRSRSSHEQGSSSQHVS-------CNLEELPSDPGKRPKMSTYHPNDQEIIRRAYLQKGP 171 Query: 100 CQLN-HAFPPRTRGKRIRRFQKEWYEEF-SWLEYS 2 CQ N H FP R G +RRF W+ EF +WLEYS Sbjct: 172 CQPNQHNFPQRKIGNSMRRFCPSWFNEFGNWLEYS 206 >ref|XP_003589867.1| hypothetical protein MTR_1g040620 [Medicago truncatula] gi|355478915|gb|AES60118.1| hypothetical protein MTR_1g040620 [Medicago truncatula] Length = 665 Score = 82.4 bits (202), Expect = 4e-14 Identities = 38/72 (52%), Positives = 51/72 (70%), Gaps = 2/72 (2%) Frame = -1 Query: 211 ELDLSSIQGDPALRKKISDYHPNDQDSVRRAYLLRGPCQ-LNHAFPPRTRGKRIRRFQKE 35 E+DL ++ +P RK++S YHPND+D +RRAYL +GPCQ H FP R G +R+F + Sbjct: 38 EVDLENLPANPGERKQLSCYHPNDRDEIRRAYLAKGPCQPKEHNFPQRPFGTFLRKFNPD 97 Query: 34 WYEEF-SWLEYS 2 W+ EF SWLEYS Sbjct: 98 WFLEFGSWLEYS 109 >ref|XP_003615119.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355516454|gb|AES98077.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 787 Score = 75.5 bits (184), Expect = 4e-12 Identities = 42/89 (47%), Positives = 57/89 (64%), Gaps = 1/89 (1%) Frame = -1 Query: 265 ETEDGGVEQPTSKRVQREELDLSSIQGDPALRKKISDYHPNDQDSVRRAYLLRGPCQLNH 86 ETE VE+P V E + + I DP LRK+I +Y P+ QD VRRAY+L+GP Q N Sbjct: 20 ETE---VEEPPPNVVN--EFNPNEIVRDPGLRKQIWEYAPDIQDQVRRAYILKGPTQPNL 74 Query: 85 AFPPRTR-GKRIRRFQKEWYEEFSWLEYS 2 A PRT+ G+ R F + WY +++W+EYS Sbjct: 75 ASFPRTQFGRDARSFSRSWYNKYTWIEYS 103 >gb|AAF82236.1|AC069143_12 Contains similarity to a transposable element Tip100 protein for transposase from Ipomoea purpurea gb|4063769 and is a member of the transmembrane 4 family PF|00335 [Arabidopsis thaliana] Length = 811 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = -1 Query: 211 ELDLSSIQGDPALRKKISDYHPNDQDSVRRAYLLRGPCQ-LNHAFPPRTRGKRIRRFQKE 35 +++L+ + DPA RK I YHPN +D VRR YL+RGPCQ H F GK +RRF + Sbjct: 56 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQIAIGKVLRRFNPK 115 Query: 34 WYEEF-SWLEYS 2 W++ + WLEYS Sbjct: 116 WFDLYGDWLEYS 127 >ref|NP_173360.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] gi|332191703|gb|AEE29824.1| TTF-type zinc finger protein with HAT dimerization domain [Arabidopsis thaliana] Length = 769 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/72 (48%), Positives = 47/72 (65%), Gaps = 2/72 (2%) Frame = -1 Query: 211 ELDLSSIQGDPALRKKISDYHPNDQDSVRRAYLLRGPCQ-LNHAFPPRTRGKRIRRFQKE 35 +++L+ + DPA RK I YHPN +D VRR YL+RGPCQ H F GK +RRF + Sbjct: 14 DINLNELPSDPAKRKSILSYHPNQRDEVRREYLIRGPCQPRGHKFKQIAIGKVLRRFNPK 73 Query: 34 WYEEF-SWLEYS 2 W++ + WLEYS Sbjct: 74 WFDLYGDWLEYS 85