BLASTX nr result
ID: Coptis25_contig00032524
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032524 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP... 82 3e-14 ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 41 1e-06 >ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP_002720173.1| ORF126 [Jatropha curcas] gi|224979608|gb|ACN72735.1| ORF126 [Jatropha curcas] gi|224979624|gb|ACN72751.1| ORF126 [Jatropha curcas] Length = 126 Score = 82.4 bits (202), Expect = 3e-14 Identities = 41/58 (70%), Positives = 44/58 (75%) Frame = -3 Query: 286 RYIDTI*TSGKMPARNPTDKVH*IVHFRDWRLTHSVTLALGVPKMGTIGSGEFDKYTD 113 R +DTI TSGKMPARNPTDKVH IV FRDWRLTHSVTLAL VPK + SG + D Sbjct: 26 RVVDTIETSGKMPARNPTDKVHYIVRFRDWRLTHSVTLALDVPKRKWVLSGRVNSIID 83 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 41.2 bits (95), Expect(2) = 1e-06 Identities = 19/22 (86%), Positives = 19/22 (86%) Frame = -2 Query: 203 GLATYSFSDFGTGRSQNGYYWV 138 GLATY FSDFGTGRSQNG Y V Sbjct: 91 GLATYPFSDFGTGRSQNGDYRV 112 Score = 35.8 bits (81), Expect(2) = 1e-06 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -3 Query: 265 TSGKMPARNPTDKVH*IV 212 TSGKMPARNP DKVH IV Sbjct: 72 TSGKMPARNPADKVHYIV 89