BLASTX nr result
ID: Coptis25_contig00032233
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032233 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativ... 77 1e-12 gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phase... 76 3e-12 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris] 76 3e-12 gb|AAG38520.1|AF283535_1 proteinase inhibitor se60-like protein ... 75 4e-12 ref|XP_003526898.1| PREDICTED: uncharacterized LOC547938 [Glycin... 75 5e-12 >ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus] gi|449529018|ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus] Length = 74 Score = 77.4 bits (189), Expect = 1e-12 Identities = 28/47 (59%), Positives = 35/47 (74%) Frame = -1 Query: 224 RYCRTPSHGYKGMCFRHVNCGLVCRNEGFAGGSCQGLRRRCFCVKPC 84 R C +PSH +KG+CF NCG +C+ EGF+GG C+G RRRCFC K C Sbjct: 27 RVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC 73 >gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus] Length = 73 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 224 RYCRTPSHGYKGMCFRHVNCGLVCRNEGFAGGSCQGLRRRCFCVKPC 84 R C + SHG+KG C NC LVCRNEGF+GG+C+G RRRCFC K C Sbjct: 27 RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC 73 >emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris] Length = 73 Score = 75.9 bits (185), Expect = 3e-12 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = -1 Query: 224 RYCRTPSHGYKGMCFRHVNCGLVCRNEGFAGGSCQGLRRRCFCVKPC 84 R C + SHG+KG C NC LVCRNEGF+GG+C+G RRRCFC K C Sbjct: 27 RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC 73 >gb|AAG38520.1|AF283535_1 proteinase inhibitor se60-like protein [Citrus x paradisi] Length = 73 Score = 75.5 bits (184), Expect = 4e-12 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 224 RYCRTPSHGYKGMCFRHVNCGLVCRNEGFAGGSCQGLRRRCFCVKPC 84 R C++ SH + G CF H NC VCRNEGF+GG C+G+RRRCFC K C Sbjct: 27 RVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC 73 >ref|XP_003526898.1| PREDICTED: uncharacterized LOC547938 [Glycine max] gi|509769|emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine max] Length = 75 Score = 75.1 bits (183), Expect = 5e-12 Identities = 29/47 (61%), Positives = 35/47 (74%) Frame = -1 Query: 224 RYCRTPSHGYKGMCFRHVNCGLVCRNEGFAGGSCQGLRRRCFCVKPC 84 R C + SHG+ G+C R NC LVCRNEGF+GG C+G RRRCFC + C Sbjct: 29 RVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC 75