BLASTX nr result
ID: Coptis25_contig00032186
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032186 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase s... 73 2e-11 sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carbo... 73 2e-11 dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase ... 73 3e-11 gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/ox... 73 3e-11 sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carbox... 72 5e-11 >gb|AAA33036.1| ribulose 1,5-bisphosphate carboxylase/oxygenase small subunit [Mesembryanthemum crystallinum] Length = 180 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +2 Query: 62 MPLASINNCATPAQASMVTPFIGLKSTSAFPVTRKVNDITFISSNGGKVSCMQ 220 M A++ TPAQASMV PF GLKS SAFPVT+K NDIT I+SNGG+V CMQ Sbjct: 5 MSNAAVVGRTTPAQASMVAPFTGLKSVSAFPVTKKSNDITSIASNGGRVQCMQ 57 >sp|Q04450.1|RBS2_MESCR RecName: Full=Ribulose bisphosphate carboxylase small chain 2, chloroplastic; Short=RuBisCO small subunit 2; Flags: Precursor gi|304444|gb|AAA03694.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Mesembryanthemum crystallinum] Length = 180 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/53 (67%), Positives = 41/53 (77%) Frame = +2 Query: 62 MPLASINNCATPAQASMVTPFIGLKSTSAFPVTRKVNDITFISSNGGKVSCMQ 220 M A++ TPAQASMV PF GLKS SAFPVT+K NDIT I+SNGG+V CMQ Sbjct: 5 MSNAAVVGRTTPAQASMVAPFTGLKSVSAFPVTKKSNDITSIASNGGRVQCMQ 57 >dbj|BAE46384.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Panax ginseng] Length = 183 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 89 ATPAQASMVTPFIGLKSTSAFPVTRKVNDITFISSNGGKVSCMQ 220 A PAQASMV PF GLKST+AFPVTRKVNDIT + SNGG+V CM+ Sbjct: 17 AVPAQASMVAPFTGLKSTAAFPVTRKVNDITSLPSNGGRVQCMK 60 >gb|AFO67218.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Aralia elata] Length = 183 Score = 72.8 bits (177), Expect = 3e-11 Identities = 34/44 (77%), Positives = 38/44 (86%) Frame = +2 Query: 89 ATPAQASMVTPFIGLKSTSAFPVTRKVNDITFISSNGGKVSCMQ 220 A PAQASMV PF GLKST+AFPVTRKVNDIT + SNGG+V CM+ Sbjct: 17 AAPAQASMVAPFTGLKSTAAFPVTRKVNDITSLPSNGGRVQCMK 60 >sp|P31333.2|RBS_GOSHI RecName: Full=Ribulose bisphosphate carboxylase small chain, chloroplastic; Short=RuBisCO small subunit; Flags: Precursor gi|450505|emb|CAA38026.1| ribulose bisphosphate carboxylase [Gossypium hirsutum] gi|371942044|gb|AEX60834.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit [Gossypium hirsutum] gi|406366448|gb|AFS41721.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (chloroplast) [Gossypium arboreum] gi|406366458|gb|AFS41726.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (chloroplast) [Gossypium hirsutum] gi|406366488|gb|AFS41741.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (chloroplast) [Gossypium tomentosum] gi|406366504|gb|AFS41749.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (chloroplast) [Gossypium mustelinum] gi|406366516|gb|AFS41755.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit (chloroplast) [Gossypium darwinii] Length = 182 Score = 72.0 bits (175), Expect = 5e-11 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = +2 Query: 83 NCATPAQASMVTPFIGLKSTSAFPVTRKV-NDITFISSNGGKVSCMQ 220 NC++PAQA+MV PF GLKS SAFPVTRK NDIT ++SNGG+V CMQ Sbjct: 15 NCSSPAQANMVAPFTGLKSASAFPVTRKANNDITSLASNGGRVQCMQ 61