BLASTX nr result
ID: Coptis25_contig00032151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032151 (232 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532027.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002532027.1| conserved hypothetical protein [Ricinus communis] gi|223528297|gb|EEF30343.1| conserved hypothetical protein [Ricinus communis] Length = 290 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/73 (36%), Positives = 45/73 (61%) Frame = -2 Query: 228 FVRAIFTMSGISKLNWEERRAFMRNLGFSHAESLSMFKRQPCIFVLSKENMQSRVEFFTV 49 F+ A+ +M+ IS+ +WE +R F+ + G+S +E L F+ QP + S++ M+ +EFF Sbjct: 146 FIYALQSMAVISRSHWERKREFLMSFGWSESEFLLAFRLQPFFMLTSEKKMKVLMEFFLT 205 Query: 48 KQNFELSDIAKNP 10 K + SDI K P Sbjct: 206 KLCLQPSDIVKCP 218