BLASTX nr result
ID: Coptis25_contig00032060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032060 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002458681.1| hypothetical protein SORBIDRAFT_03g038090 [S... 70 2e-10 ref|XP_002266206.1| PREDICTED: probable LRR receptor-like serine... 69 4e-10 ref|NP_195815.3| leucine-rich repeat protein kinase-like protein... 68 9e-10 emb|CAB82765.1| putative protein [Arabidopsis thaliana] 68 9e-10 tpg|DAA44069.1| TPA: putative leucine-rich repeat receptor-like ... 67 1e-09 >ref|XP_002458681.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor] gi|241930656|gb|EES03801.1| hypothetical protein SORBIDRAFT_03g038090 [Sorghum bicolor] Length = 970 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = -2 Query: 138 CFSCQVRAQTTDPTEVTALRAIKKSLNDPTKYLRNWNKGDPCTSNW 1 C+ R QTTDPTEV+AL+AIK SL DP+ L+NW GDPCTSNW Sbjct: 19 CYVDVTRGQTTDPTEVSALKAIKSSLVDPSNKLKNWGSGDPCTSNW 64 >ref|XP_002266206.1| PREDICTED: probable LRR receptor-like serine/threonine-protein kinase At1g06840-like [Vitis vinifera] Length = 948 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -2 Query: 138 CFSCQVRAQTTDPTEVTALRAIKKSLNDPTKYLRNWNKGDPCTSNW 1 CF A+TT P+EVTALRA+KK L DP K +RNW KGDPCTS W Sbjct: 17 CFVLLAVAETTSPSEVTALRAVKKRLIDPMKNIRNWGKGDPCTSKW 62 >ref|NP_195815.3| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] gi|332003030|gb|AED90413.1| leucine-rich repeat protein kinase-like protein [Arabidopsis thaliana] Length = 951 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 138 CFSCQVRAQTTDPTEVTALRAIKKSLNDPTKYLRNWNKGDPCTSNW 1 C AQ T P+EVTALR++K+SL DP YLRNWN+GDPC SNW Sbjct: 18 CVLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNW 63 >emb|CAB82765.1| putative protein [Arabidopsis thaliana] Length = 984 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/46 (63%), Positives = 34/46 (73%) Frame = -2 Query: 138 CFSCQVRAQTTDPTEVTALRAIKKSLNDPTKYLRNWNKGDPCTSNW 1 C AQ T P+EVTALR++K+SL DP YLRNWN+GDPC SNW Sbjct: 99 CVLLLADAQRTHPSEVTALRSVKRSLLDPKDYLRNWNRGDPCRSNW 144 >tpg|DAA44069.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] gi|414879949|tpg|DAA57080.1| TPA: putative leucine-rich repeat receptor-like protein kinase family protein [Zea mays] Length = 946 Score = 67.4 bits (163), Expect = 1e-09 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = -2 Query: 120 RAQTTDPTEVTALRAIKKSLNDPTKYLRNWNKGDPCTSNW 1 R QTTDPTEV AL+AIK SL DP+ L+NW GDPCTSNW Sbjct: 25 RGQTTDPTEVNALKAIKASLVDPSNKLKNWGSGDPCTSNW 64