BLASTX nr result
ID: Coptis25_contig00032054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00032054 (262 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320114.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002272417.2| PREDICTED: probable isoaspartyl peptidase/L-... 73 2e-11 ref|XP_003521015.1| PREDICTED: probable isoaspartyl peptidase/L-... 73 3e-11 ref|XP_004155816.1| PREDICTED: probable isoaspartyl peptidase/L-... 71 8e-11 ref|XP_002511826.1| threonine aspartase, putative [Ricinus commu... 71 1e-10 >ref|XP_002320114.1| predicted protein [Populus trichocarpa] gi|222860887|gb|EEE98429.1| predicted protein [Populus trichocarpa] Length = 419 Score = 73.9 bits (180), Expect = 1e-11 Identities = 33/48 (68%), Positives = 41/48 (85%) Frame = +3 Query: 108 DEEEKSRRFFVAVHVGAGFHSPSNEKALKSVMNRACLAAASLLEKGQG 251 + E+++ RFFVAVHVGAG+H+PSNEK L+S M RACLAAAS+L KG G Sbjct: 4 ESEDQNPRFFVAVHVGAGYHAPSNEKVLRSAMKRACLAAASILRKGPG 51 >ref|XP_002272417.2| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 4-like [Vitis vinifera] gi|297745229|emb|CBI40309.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = +3 Query: 117 EKSRRFFVAVHVGAGFHSPSNEKALKSVMNRACLAAASLLEKGQG 251 E++ RFFVAVHVGAG+H+PSNEK+L+S M RACLAAAS+L KG G Sbjct: 3 EQNPRFFVAVHVGAGYHAPSNEKSLRSAMKRACLAAASILRKGSG 47 >ref|XP_003521015.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 4-like [Glycine max] Length = 390 Score = 72.8 bits (177), Expect = 3e-11 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +3 Query: 120 KSRRFFVAVHVGAGFHSPSNEKALKSVMNRACLAAASLLEKGQGS 254 + +R+FVAVHVGAG+HSPSN+KAL+S MNRACLAAAS+L G G+ Sbjct: 2 EGKRYFVAVHVGAGYHSPSNDKALRSAMNRACLAAASVLSNGSGT 46 >ref|XP_004155816.1| PREDICTED: probable isoaspartyl peptidase/L-asparaginase 4-like [Cucumis sativus] Length = 418 Score = 71.2 bits (173), Expect = 8e-11 Identities = 32/48 (66%), Positives = 40/48 (83%) Frame = +3 Query: 108 DEEEKSRRFFVAVHVGAGFHSPSNEKALKSVMNRACLAAASLLEKGQG 251 + ++++ RF VAVHVGAGFH+PSNEKAL+S M RACLAAA +L KG G Sbjct: 4 EAQDEAHRFLVAVHVGAGFHAPSNEKALRSAMKRACLAAAVVLRKGSG 51 >ref|XP_002511826.1| threonine aspartase, putative [Ricinus communis] gi|223549006|gb|EEF50495.1| threonine aspartase, putative [Ricinus communis] Length = 419 Score = 70.9 bits (172), Expect = 1e-10 Identities = 31/46 (67%), Positives = 40/46 (86%) Frame = +3 Query: 114 EEKSRRFFVAVHVGAGFHSPSNEKALKSVMNRACLAAASLLEKGQG 251 E+++ RFF+AVHVGAG+H+PS+EK L+S M RACLAAAS+L KG G Sbjct: 6 EDQNPRFFIAVHVGAGYHAPSSEKPLRSAMKRACLAAASILRKGSG 51