BLASTX nr result
ID: Coptis25_contig00031731
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00031731 (624 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512378.1| Kinesin-3, putative [Ricinus communis] gi|22... 38 6e-06 >ref|XP_002512378.1| Kinesin-3, putative [Ricinus communis] gi|223548339|gb|EEF49830.1| Kinesin-3, putative [Ricinus communis] Length = 786 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -2 Query: 617 TKILMQPRQVSIAVRPP*AL-TKFHQHRKQVSIATLHTD 504 TK L+QPR++S+AVR P + T+ Q R++VSIATL + Sbjct: 630 TKSLLQPRRISVAVRAPLTISTQVLQPRRRVSIATLRPE 668 Score = 37.7 bits (86), Expect(2) = 6e-06 Identities = 24/62 (38%), Positives = 34/62 (54%), Gaps = 3/62 (4%) Frame = -3 Query: 388 QTDTGSVRGRL*FVRELR--RISKLFSPMPELNSTPEGEVITSVTGRSKYLGS-PS*QHG 218 Q GR F+++ R R S+LFSP+PE S E T++ SK++GS P+ Q G Sbjct: 683 QLKNSGAMGRQSFMKDPRKARYSRLFSPLPEFQSASE-TTPTAIRSSSKFMGSPPAAQAG 741 Query: 217 SW 212 W Sbjct: 742 PW 743