BLASTX nr result
ID: Coptis25_contig00031459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00031459 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|Q2ABE5.1|RBR_CAMSI RecName: Full=Retinoblastoma-related prote... 63 2e-08 ref|XP_002529988.1| conserved hypothetical protein [Ricinus comm... 62 4e-08 sp|A9UL14.1|RBR_MEDSA RecName: Full=Retinoblastoma-related prote... 62 5e-08 ref|XP_003627961.1| Retinoblastoma-related protein [Medicago tru... 62 6e-08 ref|XP_003546699.1| PREDICTED: retinoblastoma-related protein 1-... 60 2e-07 >sp|Q2ABE5.1|RBR_CAMSI RecName: Full=Retinoblastoma-related protein gi|89111303|dbj|BAE80326.1| retinoblastoma related protein [Camellia sinensis] Length = 1025 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/42 (69%), Positives = 35/42 (83%) Frame = +1 Query: 214 ILMRVILILHVPVRFRNFCILDSPRFVRKGSKGVELLASLCN 339 + + ILI+H+PVR RNF + DSPRFV KGSKGV+LLASLCN Sbjct: 230 VAILAILIIHIPVRVRNFNLHDSPRFVMKGSKGVDLLASLCN 271 >ref|XP_002529988.1| conserved hypothetical protein [Ricinus communis] gi|254789790|sp|B9SVG9.1|RBR_RICCO RecName: Full=Retinoblastoma-related protein gi|223530511|gb|EEF32393.1| conserved hypothetical protein [Ricinus communis] Length = 1020 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/37 (78%), Positives = 33/37 (89%) Frame = +1 Query: 229 ILILHVPVRFRNFCILDSPRFVRKGSKGVELLASLCN 339 ILI+HVPVRFRNF + DS RFV+KG KGV+LLASLCN Sbjct: 229 ILIIHVPVRFRNFNLNDSQRFVKKGDKGVDLLASLCN 265 >sp|A9UL14.1|RBR_MEDSA RecName: Full=Retinoblastoma-related protein; Short=MsRBR gi|62956049|gb|AAY23367.1| retinoblastoma-related protein [Medicago sativa] Length = 1025 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 214 ILMRVILILHVPVRFRNFCILDSPRFVRKGSKGVELLASLCN 339 I + ILI+HVP RFRNF I DS RFV+K SKGV+LLASLCN Sbjct: 223 ISIMAILIIHVPARFRNFNIQDSARFVKKSSKGVDLLASLCN 264 >ref|XP_003627961.1| Retinoblastoma-related protein [Medicago truncatula] gi|355521983|gb|AET02437.1| Retinoblastoma-related protein [Medicago truncatula] Length = 1052 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +1 Query: 214 ILMRVILILHVPVRFRNFCILDSPRFVRKGSKGVELLASLCN 339 I + ILI+HVP RFRNF I DS RFV+K SKGV+LLASLCN Sbjct: 250 ISIMAILIIHVPARFRNFNIHDSARFVKKSSKGVDLLASLCN 291 >ref|XP_003546699.1| PREDICTED: retinoblastoma-related protein 1-like [Glycine max] Length = 1002 Score = 60.1 bits (144), Expect = 2e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = +1 Query: 214 ILMRVILILHVPVRFRNFCILDSPRFVRKGSKGVELLASLCN 339 I + ILI+HVP RFRNF I DS RFV+K +KGV+LLASLCN Sbjct: 213 ISILAILIIHVPTRFRNFNIHDSSRFVKKSNKGVDLLASLCN 254