BLASTX nr result
ID: Coptis25_contig00031353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00031353 (257 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512317.1| ATP binding protein, putative [Ricinus commu... 55 6e-06 >ref|XP_002512317.1| ATP binding protein, putative [Ricinus communis] gi|223548278|gb|EEF49769.1| ATP binding protein, putative [Ricinus communis] Length = 436 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/54 (55%), Positives = 38/54 (70%) Frame = +2 Query: 2 VVKLLRGDEVGLELVKQFQRSFQQKTTYSEELFDSEEYYSTLHQNDLNQHKKIA 163 VV LLRGDE E K+ QR Q+T YSEEL D++EY ST + NDL +HK++A Sbjct: 381 VVILLRGDEYVRECAKENQRKTLQRT-YSEELLDAQEYNSTKYLNDLKRHKELA 433