BLASTX nr result
ID: Coptis25_contig00031243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00031243 (379 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004158348.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 1e-08 ref|XP_004141084.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 64 1e-08 ref|XP_002517345.1| peptidyl-prolyl cis-trans isomerase, putativ... 64 1e-08 ref|XP_003541508.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 61 8e-08 sp|O49939.1|TLP40_SPIOL RecName: Full=Peptidyl-prolyl cis-trans ... 60 2e-07 >ref|XP_004158348.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like, partial [Cucumis sativus] Length = 350 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 DFLADLKVGDVITSMQVVSGLDNLVNPTYKIAG 99 DFLADLKVGDVI SMQVVSGLDNLVNP+YKIAG Sbjct: 318 DFLADLKVGDVIESMQVVSGLDNLVNPSYKIAG 350 >ref|XP_004141084.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like [Cucumis sativus] Length = 447 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 DFLADLKVGDVITSMQVVSGLDNLVNPTYKIAG 99 DFLADLKVGDVI SMQVVSGLDNLVNP+YKIAG Sbjct: 415 DFLADLKVGDVIESMQVVSGLDNLVNPSYKIAG 447 >ref|XP_002517345.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] gi|223543356|gb|EEF44887.1| peptidyl-prolyl cis-trans isomerase, putative [Ricinus communis] Length = 465 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 1 DFLADLKVGDVITSMQVVSGLDNLVNPTYKIAG 99 DFLADLKVGDVI SMQVVSGLDNLVNP+YKIAG Sbjct: 433 DFLADLKVGDVIESMQVVSGLDNLVNPSYKIAG 465 >ref|XP_003541508.1| PREDICTED: peptidyl-prolyl cis-trans isomerase CYP38, chloroplastic-like [Glycine max] Length = 775 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 1 DFLADLKVGDVITSMQVVSGLDNLVNPTYKIAG 99 D+LADLKVGDVI S++VVSGLDNLVNPTYKIAG Sbjct: 743 DYLADLKVGDVIESIKVVSGLDNLVNPTYKIAG 775 >sp|O49939.1|TLP40_SPIOL RecName: Full=Peptidyl-prolyl cis-trans isomerase, chloroplastic; AltName: Full=40 kDa thylakoid lumen PPIase; AltName: Full=40 kDa thylakoid lumen rotamase; Flags: Precursor gi|2864602|emb|CAA72792.1| thylakoid lumen rotamase [Spinacia oleracea] Length = 449 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 1 DFLADLKVGDVITSMQVVSGLDNLVNPTYKIAG 99 D+LADLKVGDVI S+Q VSG+DNLVNPTYKIAG Sbjct: 417 DYLADLKVGDVIESVQAVSGVDNLVNPTYKIAG 449