BLASTX nr result
ID: Coptis25_contig00031016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00031016 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002864814.1| leucine-rich repeat family protein [Arabidop... 55 8e-06 >ref|XP_002864814.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] gi|297310649|gb|EFH41073.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. lyrata] Length = 604 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 4/48 (8%) Frame = -3 Query: 139 MGTWVFVFSV----TLFITCSLALSPDGEALLEMKKTLNDSRSSLRSW 8 MG ++VFSV TLF++CS AL+PDG ALLE+K ND+R+SL +W Sbjct: 1 MGISIWVFSVISAATLFVSCSSALTPDGFALLELKSGFNDTRNSLENW 48