BLASTX nr result
ID: Coptis25_contig00030703
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030703 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002867450.1| hypothetical protein ARALYDRAFT_491934 [Arab... 67 1e-09 gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana] 67 1e-09 ref|NP_194568.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana... 67 1e-09 ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitoch... 66 3e-09 ref|XP_002275525.2| PREDICTED: ADP,ATP carrier protein 3, mitoch... 66 3e-09 >ref|XP_002867450.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. lyrata] gi|297313286|gb|EFH43709.1| hypothetical protein ARALYDRAFT_491934 [Arabidopsis lyrata subsp. lyrata] Length = 380 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 1 KSLFKGAVANIFRAVAGAGVLAGYDKLQLIVLGKKY 108 KSLFKGA ANI RAVAGAGVLAGYDKLQLIVLGKKY Sbjct: 340 KSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKY 375 >gb|AAM65696.1| ADP,ATP carrier-like protein [Arabidopsis thaliana] Length = 379 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 1 KSLFKGAVANIFRAVAGAGVLAGYDKLQLIVLGKKY 108 KSLFKGA ANI RAVAGAGVLAGYDKLQLIVLGKKY Sbjct: 339 KSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKY 374 >ref|NP_194568.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana] gi|75219626|sp|O49447.1|ADT3_ARATH RecName: Full=ADP,ATP carrier protein 3, mitochondrial; AltName: Full=ADP/ATP translocase 3; AltName: Full=Adenine nucleotide translocator 3; Short=ANT 3; Flags: Precursor gi|2842480|emb|CAA16877.1| ADP, ATP carrier-like protein [Arabidopsis thaliana] gi|7269693|emb|CAB79641.1| ADP, ATP carrier-like protein [Arabidopsis thaliana] gi|26451091|dbj|BAC42650.1| putative ADP,ATP carrier [Arabidopsis thaliana] gi|332660077|gb|AEE85477.1| ADP/ATP carrier 3 protein [Arabidopsis thaliana] Length = 379 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = +1 Query: 1 KSLFKGAVANIFRAVAGAGVLAGYDKLQLIVLGKKY 108 KSLFKGA ANI RAVAGAGVLAGYDKLQLIVLGKKY Sbjct: 339 KSLFKGAGANILRAVAGAGVLAGYDKLQLIVLGKKY 374 >ref|XP_004136845.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis sativus] gi|449526257|ref|XP_004170130.1| PREDICTED: ADP,ATP carrier protein 3, mitochondrial-like [Cucumis sativus] Length = 378 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 KSLFKGAVANIFRAVAGAGVLAGYDKLQLIVLGKKY 108 KSLFKGA ANI RAVAGAGVLAGYDKLQL+VLGKKY Sbjct: 337 KSLFKGAGANILRAVAGAGVLAGYDKLQLLVLGKKY 372 >ref|XP_002275525.2| PREDICTED: ADP,ATP carrier protein 3, mitochondrial [Vitis vinifera] Length = 415 Score = 66.2 bits (160), Expect = 3e-09 Identities = 33/36 (91%), Positives = 34/36 (94%) Frame = +1 Query: 1 KSLFKGAVANIFRAVAGAGVLAGYDKLQLIVLGKKY 108 KSLFKGA ANI RAVAGAGVLAGYDKLQL+VLGKKY Sbjct: 374 KSLFKGAGANILRAVAGAGVLAGYDKLQLLVLGKKY 409