BLASTX nr result
ID: Coptis25_contig00030642
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030642 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202... 66 3e-09 ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202... 66 3e-09 emb|CBI20927.3| unnamed protein product [Vitis vinifera] 66 3e-09 ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250... 66 3e-09 ref|XP_002516617.1| electron carrier, putative [Ricinus communis... 66 3e-09 >ref|XP_004138752.1| PREDICTED: uncharacterized protein LOC101202753 isoform 2 [Cucumis sativus] Length = 158 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 QSWRLACQTIVGNKENSGKVVVQRLPQWKK 91 +SWRLACQTIVGNKENSGKVVVQRLPQWKK Sbjct: 129 ESWRLACQTIVGNKENSGKVVVQRLPQWKK 158 >ref|XP_004138751.1| PREDICTED: uncharacterized protein LOC101202753 isoform 1 [Cucumis sativus] Length = 176 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 QSWRLACQTIVGNKENSGKVVVQRLPQWKK 91 +SWRLACQTIVGNKENSGKVVVQRLPQWKK Sbjct: 147 ESWRLACQTIVGNKENSGKVVVQRLPQWKK 176 >emb|CBI20927.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 QSWRLACQTIVGNKENSGKVVVQRLPQWKK 91 +SWRLACQTIVGNKENSGKVVVQRLPQWKK Sbjct: 108 ESWRLACQTIVGNKENSGKVVVQRLPQWKK 137 >ref|XP_002281853.1| PREDICTED: uncharacterized protein LOC100250753 [Vitis vinifera] Length = 172 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 QSWRLACQTIVGNKENSGKVVVQRLPQWKK 91 +SWRLACQTIVGNKENSGKVVVQRLPQWKK Sbjct: 143 ESWRLACQTIVGNKENSGKVVVQRLPQWKK 172 >ref|XP_002516617.1| electron carrier, putative [Ricinus communis] gi|223544437|gb|EEF45958.1| electron carrier, putative [Ricinus communis] Length = 171 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 QSWRLACQTIVGNKENSGKVVVQRLPQWKK 91 +SWRLACQTIVGNKENSGKVVVQRLPQWKK Sbjct: 142 ESWRLACQTIVGNKENSGKVVVQRLPQWKK 171