BLASTX nr result
ID: Coptis25_contig00030626
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030626 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera]... 102 2e-20 ref|XP_002515888.1| conserved hypothetical protein [Ricinus comm... 95 5e-18 ref|XP_003533021.1| PREDICTED: anoctamin-8-like [Glycine max] 89 3e-16 ref|XP_003529740.1| PREDICTED: anoctamin-8-like [Glycine max] 89 4e-16 ref|XP_003567040.1| PREDICTED: anoctamin-10-like [Brachypodium d... 89 5e-16 >ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera] gi|297743119|emb|CBI35986.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 102 bits (255), Expect = 2e-20 Identities = 48/58 (82%), Positives = 54/58 (93%) Frame = -1 Query: 175 GLSEEFIKVAAPLETLGRATVELQIKKPTYIGMDL*FEWDEVEAFVRQPNGSLFSWCE 2 G+++EFIK+AAPLETLGRA ELQIKKPT+IGMDL FEWDEVEAFVRQP+GSLFSW E Sbjct: 51 GIADEFIKLAAPLETLGRAAAELQIKKPTHIGMDLQFEWDEVEAFVRQPDGSLFSWWE 108 >ref|XP_002515888.1| conserved hypothetical protein [Ricinus communis] gi|223544793|gb|EEF46308.1| conserved hypothetical protein [Ricinus communis] Length = 655 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/58 (74%), Positives = 52/58 (89%) Frame = -1 Query: 175 GLSEEFIKVAAPLETLGRATVELQIKKPTYIGMDL*FEWDEVEAFVRQPNGSLFSWCE 2 GL++EFIK+AAPL TLG+A ELQ+KK TYIGMDL FEW+E++ FVRQP+GSLFSWCE Sbjct: 55 GLTDEFIKLAAPLVTLGKAAAELQMKKLTYIGMDLQFEWEELKVFVRQPDGSLFSWCE 112 >ref|XP_003533021.1| PREDICTED: anoctamin-8-like [Glycine max] Length = 803 Score = 89.4 bits (220), Expect = 3e-16 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = -1 Query: 175 GLSEEFIKVAAPLETLGRATVELQIKKPTYIGMDL*FEWDEVEAFVRQPNGSLFSWCE 2 G+++EFIK+AAPLETLGRA ELQIKK T IGMDL FE +EVEAFV+QP+GS+FSW E Sbjct: 196 GIADEFIKLAAPLETLGRAAAELQIKKQTLIGMDLQFEVEEVEAFVKQPDGSVFSWYE 253 >ref|XP_003529740.1| PREDICTED: anoctamin-8-like [Glycine max] Length = 658 Score = 89.0 bits (219), Expect = 4e-16 Identities = 43/58 (74%), Positives = 51/58 (87%) Frame = -1 Query: 175 GLSEEFIKVAAPLETLGRATVELQIKKPTYIGMDL*FEWDEVEAFVRQPNGSLFSWCE 2 G+++EFIK+AAPLETLGRA ELQIKK T IGMDL FE +EVEAFV+QP+GS+FSW E Sbjct: 51 GIADEFIKLAAPLETLGRAAAELQIKKRTLIGMDLQFEVEEVEAFVKQPDGSVFSWYE 108 >ref|XP_003567040.1| PREDICTED: anoctamin-10-like [Brachypodium distachyon] Length = 655 Score = 88.6 bits (218), Expect = 5e-16 Identities = 41/58 (70%), Positives = 49/58 (84%) Frame = -1 Query: 175 GLSEEFIKVAAPLETLGRATVELQIKKPTYIGMDL*FEWDEVEAFVRQPNGSLFSWCE 2 G+ EFIK++AP+E LGRA E+Q+KK TYIGMDL FEWD+V AFVRQP+GSLFSW E Sbjct: 52 GVPAEFIKLSAPMEILGRAAAEMQMKKLTYIGMDLQFEWDQVAAFVRQPDGSLFSWRE 109