BLASTX nr result
ID: Coptis25_contig00030507
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030507 (256 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK34226.1| unknown [Lotus japonicus] 58 7e-07 ref|XP_003520812.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >gb|AFK34226.1| unknown [Lotus japonicus] Length = 253 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 179 AEADYLYSLITKAKFENNRYQKPRREPMVTIYNVDMF 69 AEAD LYSLITKAKFENNRYQKP+++P + +VD F Sbjct: 217 AEADLLYSLITKAKFENNRYQKPKKQPKTSTQHVDWF 253 >ref|XP_003520812.1| PREDICTED: pentatricopeptide repeat-containing protein At3g05340-like [Glycine max] Length = 753 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = -3 Query: 179 AEADYLYSLITKAKFENNRYQKPRREPMVTIYNVDMF 69 AEAD LYSLITKAKFENNRYQKP+++P + +VD F Sbjct: 717 AEADLLYSLITKAKFENNRYQKPKKQPKSSSQHVDWF 753