BLASTX nr result
ID: Coptis25_contig00030452
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030452 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF25984.1|AC013354_3 F15H18.12 [Arabidopsis thaliana] 72 5e-11 ref|NP_173273.2| ATP binding microtubule motor family protein [A... 72 5e-11 ref|XP_002893000.1| hypothetical protein ARALYDRAFT_472057 [Arab... 71 1e-10 ref|XP_002321490.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 emb|CBI15491.3| unnamed protein product [Vitis vinifera] 64 1e-08 >gb|AAF25984.1|AC013354_3 F15H18.12 [Arabidopsis thaliana] Length = 1003 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 3 CESGNASKEMFELNFALPSDKRQWFLGWDPISNLIHL 113 CESGN SKEMFELNFA+PSDKRQW +GWD ISNL+HL Sbjct: 967 CESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL 1003 >ref|NP_173273.2| ATP binding microtubule motor family protein [Arabidopsis thaliana] gi|19979627|dbj|BAB88748.1| AtNACK1 kinesin-like protein [Arabidopsis thaliana] gi|332191587|gb|AEE29708.1| ATP binding microtubule motor family protein [Arabidopsis thaliana] Length = 974 Score = 72.0 bits (175), Expect = 5e-11 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +3 Query: 3 CESGNASKEMFELNFALPSDKRQWFLGWDPISNLIHL 113 CESGN SKEMFELNFA+PSDKRQW +GWD ISNL+HL Sbjct: 938 CESGNISKEMFELNFAVPSDKRQWNIGWDNISNLLHL 974 >ref|XP_002893000.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. lyrata] gi|297338842|gb|EFH69259.1| hypothetical protein ARALYDRAFT_472057 [Arabidopsis lyrata subsp. lyrata] Length = 974 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +3 Query: 3 CESGNASKEMFELNFALPSDKRQWFLGWDPISNLIHL 113 CESGN SKEMFELNFA+PSD+RQW +GWD ISNL+HL Sbjct: 938 CESGNISKEMFELNFAVPSDRRQWNIGWDNISNLLHL 974 >ref|XP_002321490.1| predicted protein [Populus trichocarpa] gi|222868486|gb|EEF05617.1| predicted protein [Populus trichocarpa] Length = 965 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +3 Query: 3 CESGNASKEMFELNFALPSDKRQWFLGWDPISNLIHL 113 CE GN SKEMFELNFALP+DKR W +GW+PISN +HL Sbjct: 929 CEGGNMSKEMFELNFALPTDKRPWIMGWNPISNFLHL 965 >emb|CBI15491.3| unnamed protein product [Vitis vinifera] Length = 849 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +3 Query: 3 CESGNASKEMFELNFALPSDKRQWFLGWDPISNLIHL 113 CES N SKEMFELNF LP+DKR W GW+ ISNL+HL Sbjct: 813 CESSNMSKEMFELNFVLPADKRPWVTGWNQISNLLHL 849