BLASTX nr result
ID: Coptis25_contig00030367
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030367 (1121 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534404.1| conserved hypothetical protein [Ricinus comm... 58 4e-06 >ref|XP_002534404.1| conserved hypothetical protein [Ricinus communis] gi|223525361|gb|EEF27982.1| conserved hypothetical protein [Ricinus communis] Length = 181 Score = 58.2 bits (139), Expect = 4e-06 Identities = 31/73 (42%), Positives = 43/73 (58%), Gaps = 2/73 (2%) Frame = -3 Query: 882 RICKPWTNCLNGKIFGRKVSVKHL--M*KME*KTLFSIILLLLDNDYFILKLSMKDDLDY 709 R+ K W L K+ GR + +L + K K SI L+ LDND++I KLS K+D D+ Sbjct: 71 RMRKSWKQTLIIKLLGRSIGHNYLFRIVKELWKAKGSIDLVALDNDFYIAKLSFKNDYDF 130 Query: 708 VLTEGPWFIADYY 670 L EGPW + D+Y Sbjct: 131 ALFEGPWMVVDHY 143