BLASTX nr result
ID: Coptis25_contig00030039
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030039 (305 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002320330.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002320329.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002523123.1| structural constituent of cell wall, putativ... 55 5e-06 ref|XP_002523124.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002320330.1| predicted protein [Populus trichocarpa] gi|222861103|gb|EEE98645.1| predicted protein [Populus trichocarpa] Length = 361 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -2 Query: 304 SSPMKECNVPTNVNMGSSGALPYSSYRLLTKKKMKLYSVGPFVYRPTKP 158 SSP+K CNVPT++N G +GA P S+Y +L KK+KLYS+ F Y T P Sbjct: 307 SSPLKTCNVPTDMNYGITGA-PLSAYHILHDKKIKLYSMRTFFYTSTTP 354 >ref|XP_002320329.1| predicted protein [Populus trichocarpa] gi|222861102|gb|EEE98644.1| predicted protein [Populus trichocarpa] Length = 265 Score = 55.8 bits (133), Expect = 3e-06 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = -2 Query: 304 SSPMKECNVPTNVNMGSSGALPYSSYRLLTKKKMKLYSVGPFVYRPTKP 158 SSP+K CNVPT++N G +GA P S+Y +L KK+KLYS+ F Y T P Sbjct: 211 SSPLKTCNVPTDMNYGITGA-PLSAYHILHDKKIKLYSMRTFFYTSTTP 258 >ref|XP_002523123.1| structural constituent of cell wall, putative [Ricinus communis] gi|223537685|gb|EEF39308.1| structural constituent of cell wall, putative [Ricinus communis] Length = 486 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -2 Query: 301 SPMKECNVPTNVNMGSSGALPYSSYRLLTKKKMKLYSVGPFVYRPTKPK 155 SP++ C++PT+VN G +GA SSYR+L+ KK+KL+SVGPF Y ++PK Sbjct: 433 SPLETCSIPTDVNKGITGA-HLSSYRILSDKKLKLFSVGPFFY-TSEPK 479 >ref|XP_002523124.1| conserved hypothetical protein [Ricinus communis] gi|223537686|gb|EEF39309.1| conserved hypothetical protein [Ricinus communis] Length = 636 Score = 54.7 bits (130), Expect = 8e-06 Identities = 27/49 (55%), Positives = 38/49 (77%) Frame = -2 Query: 301 SPMKECNVPTNVNMGSSGALPYSSYRLLTKKKMKLYSVGPFVYRPTKPK 155 SP+ C++PT+VN G +GA SSYR+L+ KK+KL+SVGPF Y ++PK Sbjct: 583 SPLDTCDIPTDVNKGITGA-HLSSYRILSDKKLKLFSVGPFFY-TSEPK 629