BLASTX nr result
ID: Coptis25_contig00030007
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00030007 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263186.2| PREDICTED: LRR receptor-like serine/threonin... 57 2e-06 >ref|XP_002263186.2| PREDICTED: LRR receptor-like serine/threonine-protein kinase HSL2-like [Vitis vinifera] Length = 657 Score = 56.6 bits (135), Expect = 2e-06 Identities = 24/55 (43%), Positives = 37/55 (67%) Frame = -1 Query: 406 GNAGLCSPDLKPFPPCLKTKASTWFLIGVIFCLSLMVHVLVFWLLRRKQEQLTGK 242 GN LCSP+LKP PPC ++K +T +LIGV+ +L++ +FW L+ + + GK Sbjct: 282 GNPNLCSPNLKPLPPCSRSKPATLYLIGVLAIFTLILLGSLFWFLKTRSKIFGGK 336