BLASTX nr result
ID: Coptis25_contig00029906
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029906 (246 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004148387.1| PREDICTED: carotenoid cleavage dioxygenase 8... 67 2e-09 gb|ADP37984.1| carotenoid cleavage dioxygenase 8 [Actinidia chin... 66 3e-09 ref|XP_003522713.1| PREDICTED: carotenoid cleavage dioxygenase 8... 64 1e-08 ref|XP_002324797.1| predicted protein [Populus trichocarpa] gi|2... 64 1e-08 gb|AAW59435.1| decreased apical dominance protein [Petunia x hyb... 64 2e-08 >ref|XP_004148387.1| PREDICTED: carotenoid cleavage dioxygenase 8, chloroplastic-like [Cucumis sativus] gi|449531816|ref|XP_004172881.1| PREDICTED: carotenoid cleavage dioxygenase 8, chloroplastic-like [Cucumis sativus] Length = 547 Score = 66.6 bits (161), Expect = 2e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 LLDGSTFKEIARAKFPYGLPYGLHACWIPNN 153 LLDGSTF+EIARAKFPYGLPYGLH CW+P N Sbjct: 517 LLDGSTFEEIARAKFPYGLPYGLHGCWVPKN 547 >gb|ADP37984.1| carotenoid cleavage dioxygenase 8 [Actinidia chinensis] Length = 556 Score = 65.9 bits (159), Expect = 3e-09 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 245 LLDGSTFKEIARAKFPYGLPYGLHACWIPNN 153 +LDGSTF+EIARAKFPYGLPYGLH CWIP N Sbjct: 526 VLDGSTFEEIARAKFPYGLPYGLHGCWIPKN 556 >ref|XP_003522713.1| PREDICTED: carotenoid cleavage dioxygenase 8, chloroplastic-like [Glycine max] Length = 549 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 245 LLDGSTFKEIARAKFPYGLPYGLHACWIP 159 LLDGSTF+EIARAKFPYGLPYGLH CW+P Sbjct: 519 LLDGSTFEEIARAKFPYGLPYGLHGCWVP 547 >ref|XP_002324797.1| predicted protein [Populus trichocarpa] gi|222866231|gb|EEF03362.1| predicted protein [Populus trichocarpa] Length = 538 Score = 64.3 bits (155), Expect = 1e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 245 LLDGSTFKEIARAKFPYGLPYGLHACWIP 159 LLDGSTF+EIARAKFPYGLPYGLH CW+P Sbjct: 508 LLDGSTFEEIARAKFPYGLPYGLHGCWVP 536 >gb|AAW59435.1| decreased apical dominance protein [Petunia x hybrida] Length = 556 Score = 63.5 bits (153), Expect = 2e-08 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -2 Query: 245 LLDGSTFKEIARAKFPYGLPYGLHACWIP 159 +LDGSTF+EIARAKFPYGLPYGLH CW+P Sbjct: 526 ILDGSTFEEIARAKFPYGLPYGLHGCWVP 554