BLASTX nr result
ID: Coptis25_contig00029511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029511 (467 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635109.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 >ref|XP_003635109.1| PREDICTED: pentatricopeptide repeat-containing protein At5g24830-like [Vitis vinifera] Length = 580 Score = 65.5 bits (158), Expect = 4e-09 Identities = 38/119 (31%), Positives = 61/119 (51%), Gaps = 18/119 (15%) Frame = -2 Query: 313 MVSIVAHQDFHIFLRIIHHTNIRIEAFVNTITQLFTNIHFVLPRNDERS----------- 167 M + Q+ H+F R+ N IE+ + + Q+F N+ P + + Sbjct: 1 MALSIVFQESHVFFRLF---NACIESIKHDVAQIFANVFSFKPYSPANNRPSGHGNLLPF 57 Query: 166 -LND------DSYQINPQDWFLKKETHHNDNEDPHAVFNALDSVLKDTLDRLKKIRESI 11 L D + YQ+ QDWF + + H ++ DP VFN LD++LKD+L+RLK +RES+ Sbjct: 58 ALEDLIISVGNQYQVTTQDWFSQNKGH-DEERDPRVVFNVLDAILKDSLERLKMMRESV 115