BLASTX nr result
ID: Coptis25_contig00029484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029484 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267404.1| PREDICTED: two-component response regulator ... 55 5e-06 >ref|XP_002267404.1| PREDICTED: two-component response regulator ARR9 [Vitis vinifera] Length = 220 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 529 EEGAEEFLLKPVQLSDVKRLRPHLLKGKSR 440 EEGAE+F LKPVQLSDV +LRPHLLKGK+R Sbjct: 120 EEGAEDFFLKPVQLSDVNKLRPHLLKGKAR 149