BLASTX nr result
ID: Coptis25_contig00029447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029447 (1073 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago ... 61 5e-07 >ref|XP_003637202.1| hypothetical protein MTR_077s0013 [Medicago truncatula] gi|355503137|gb|AES84340.1| hypothetical protein MTR_077s0013 [Medicago truncatula] Length = 586 Score = 60.8 bits (146), Expect = 5e-07 Identities = 30/57 (52%), Positives = 39/57 (68%), Gaps = 2/57 (3%) Frame = +3 Query: 198 MVRRGRPRKIGQARMDAAIDALHPMGYDIPLIRRKVNELLEIYQGH--WEIIEQGPY 362 M R RP K G +RMDAA+DA+ P+G+D LI + VN+LL+IY G+ W IE G Y Sbjct: 1 MAPRRRPLKKGDSRMDAALDAMTPLGFDKKLIHQTVNKLLKIYDGNEGWHFIEDGAY 57