BLASTX nr result
ID: Coptis25_contig00029271
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029271 (646 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulga... 52 2e-06 >emb|CCA66009.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1378 Score = 52.0 bits (123), Expect(2) = 2e-06 Identities = 20/32 (62%), Positives = 24/32 (75%) Frame = -1 Query: 106 EINVKWDCPPKGWLKLNMDGSSHGNPGAVGAG 11 EI V+W CP +GW+KLN DG+S GNPG G G Sbjct: 1204 EILVRWQCPKEGWVKLNTDGASKGNPGPAGGG 1235 Score = 25.4 bits (54), Expect(2) = 2e-06 Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 10/56 (17%) Frame = -3 Query: 239 TLLGTE--------LWYIWLARNEKKFTGTKQYPLSCV--IKAKKINVKQSEDDGD 102 T++G+E W++W RN++ F P+ V I A+ +K++ D D Sbjct: 1137 TMMGSEWLRVFAVSCWWLWRWRNDRCFNRNPSIPIDQVSFIFARVKEIKEAMDRND 1192