BLASTX nr result
ID: Coptis25_contig00029219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029219 (561 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532684.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 ref|XP_002316920.1| predicted protein [Populus trichocarpa] gi|2... 57 3e-06 >ref|XP_002532684.1| conserved hypothetical protein [Ricinus communis] gi|223527581|gb|EEF29697.1| conserved hypothetical protein [Ricinus communis] Length = 117 Score = 63.5 bits (153), Expect = 2e-08 Identities = 39/77 (50%), Positives = 47/77 (61%), Gaps = 3/77 (3%) Frame = +1 Query: 187 ASPRPHRIV--SYAPSSHSISSRGTHREGALSGNRLRRRY-ASRELLKRALAPPVHRSNQ 357 +SPRP S P S S G L ++LRR + ASRE+L+RALAPP + + Sbjct: 44 SSPRPRSTCTCSNRPGSVRCSKHGY----VLPSDKLRRHHQASREILRRALAPPNRKMSL 99 Query: 358 RCWNFRPTPSRLSRMSM 408 R WNFRPTPSRLS MSM Sbjct: 100 RWWNFRPTPSRLSNMSM 116 >ref|XP_002329111.1| predicted protein [Populus trichocarpa] gi|222869780|gb|EEF06911.1| predicted protein [Populus trichocarpa] Length = 108 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/75 (46%), Positives = 43/75 (57%), Gaps = 2/75 (2%) Frame = +1 Query: 190 SPRPHRIV--SYAPSSHSISSRGTHREGALSGNRLRRRYASRELLKRALAPPVHRSNQRC 363 SPRP S P S S G + ++LRR A+ E+L+RALAPP R R Sbjct: 37 SPRPRSTCTCSNRPGSVRCSKHGY----LVPSDKLRRNQANTEILRRALAPPNRRLTLRW 92 Query: 364 WNFRPTPSRLSRMSM 408 +NF+PTPSRLS MSM Sbjct: 93 FNFQPTPSRLSNMSM 107 >ref|XP_002316920.1| predicted protein [Populus trichocarpa] gi|222859985|gb|EEE97532.1| predicted protein [Populus trichocarpa] Length = 109 Score = 56.6 bits (135), Expect = 3e-06 Identities = 35/72 (48%), Positives = 40/72 (55%) Frame = +1 Query: 193 PRPHRIVSYAPSSHSISSRGTHREGALSGNRLRRRYASRELLKRALAPPVHRSNQRCWNF 372 PR S P S S G G +RR A++ELL+RALAPP R R +NF Sbjct: 40 PRSTCTCSNRPGSVRCSKHGYMVPG---DKLIRRHQANKELLRRALAPPNRRLTLRWFNF 96 Query: 373 RPTPSRLSRMSM 408 RPTPSRLS MSM Sbjct: 97 RPTPSRLSNMSM 108