BLASTX nr result
ID: Coptis25_contig00029065
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00029065 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517454.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002517454.1| conserved hypothetical protein [Ricinus communis] gi|223543465|gb|EEF44996.1| conserved hypothetical protein [Ricinus communis] Length = 401 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/95 (33%), Positives = 52/95 (54%), Gaps = 3/95 (3%) Frame = -2 Query: 294 SEEFEMSGIMSKLPIEIFFDILSRLPIESLSHCRWVSKAWYNAIKDPCFIELQHTKVIHD 115 SE FE KLP EI+FDILSR PI SL C+ VS+ WY ++++P + + Sbjct: 16 SESFE------KLPQEIYFDILSRQPIVSLLECKPVSRHWYTSVRNPLLANMHLNRAAEQ 69 Query: 114 NCYCVIFYD---KFEVDYHLVSNEDLEALETVAIP 19 N C++F+ + +++ V + + L+T+ P Sbjct: 70 N-LCLLFFSDWPRSKLELVQVEHPEPRKLKTLKTP 103