BLASTX nr result
ID: Coptis25_contig00028944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028944 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 5e-06 >emb|CCA66036.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1369 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/56 (41%), Positives = 35/56 (62%) Frame = +1 Query: 97 ISWNCRGCGGQSTIRQIKNLISKENPDIIFLSETKSKSQHMQYLSNILNYPFFFSI 264 +SWNCRG G S + ++ L++ ENP I+FLSETK KS M+ + L + ++ Sbjct: 5 LSWNCRGMGSPSALSALRRLLASENPQIVFLSETKLKSYEMESVKKKLKWEHMVAV 60