BLASTX nr result
ID: Coptis25_contig00028908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028908 (430 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADL36700.1| GRF domain class transcription factor [Malus x do... 59 3e-07 emb|CBI34676.3| unnamed protein product [Vitis vinifera] 55 6e-06 ref|XP_002269986.1| PREDICTED: putative Holliday junction resolv... 55 6e-06 >gb|ADL36700.1| GRF domain class transcription factor [Malus x domestica] Length = 170 Score = 59.3 bits (142), Expect = 3e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -2 Query: 429 SVEGLLKHLHLDPVTSKTILDKFAAVGILQEYLDYMQREFRS 304 +VE LLK L+L PV SKTI+DKFAAVGILQ YLDY+ RE +S Sbjct: 125 NVELLLKPLNLPPVQSKTIMDKFAAVGILQGYLDYVNRELKS 166 >emb|CBI34676.3| unnamed protein product [Vitis vinifera] Length = 224 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 429 SVEGLLKHLHLDPVTSKTILDKFAAVGILQEYLDYMQREFRS 304 +VE LLK L+L PV SKTILDKFAAVGILQ YLD++ R +S Sbjct: 180 NVELLLKPLNLHPVQSKTILDKFAAVGILQGYLDHVNRILKS 221 >ref|XP_002269986.1| PREDICTED: putative Holliday junction resolvase [Vitis vinifera] Length = 169 Score = 55.1 bits (131), Expect = 6e-06 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -2 Query: 429 SVEGLLKHLHLDPVTSKTILDKFAAVGILQEYLDYMQREFRS 304 +VE LLK L+L PV SKTILDKFAAVGILQ YLD++ R +S Sbjct: 125 NVELLLKPLNLHPVQSKTILDKFAAVGILQGYLDHVNRILKS 166