BLASTX nr result
ID: Coptis25_contig00028589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028589 (307 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519607.1| serine-threonine protein kinase, plant-type,... 118 6e-25 ref|XP_003544276.1| PREDICTED: probable L-type lectin-domain con... 115 3e-24 ref|XP_003615494.1| Lectin-domain containing receptor kinase A4.... 115 3e-24 ref|XP_003519228.1| PREDICTED: probable L-type lectin-domain con... 114 6e-24 ref|XP_002270021.2| PREDICTED: probable L-type lectin-domain con... 110 1e-22 >ref|XP_002519607.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223541197|gb|EEF42752.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Length = 681 Score = 118 bits (295), Expect = 6e-25 Identities = 60/82 (73%), Positives = 68/82 (82%) Frame = -2 Query: 303 NVTKSISFQNFHLRTNPRISHDVKLLGSAKFSNENGSIQIPDPSQTIDLKHQAGRAIYSS 124 NVTK +SF +F L NPRI H+++LLGSAK S E G+IQIPD SQ DLKHQAGRAIYS Sbjct: 44 NVTKHLSFPDFSL-DNPRIIHEIQLLGSAKVSKEKGAIQIPDESQATDLKHQAGRAIYSF 102 Query: 123 PIRLLDPLTHSPASFDTTFSFQ 58 PIRLLDPLT +PASF+TTFSFQ Sbjct: 103 PIRLLDPLTATPASFETTFSFQ 124 >ref|XP_003544276.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] Length = 670 Score = 115 bits (289), Expect = 3e-24 Identities = 57/83 (68%), Positives = 66/83 (79%) Frame = -2 Query: 303 NVTKSISFQNFHLRTNPRISHDVKLLGSAKFSNENGSIQIPDPSQTIDLKHQAGRAIYSS 124 NVTK SF NF NPR+ HDVKLLGSAKFSNE G++QIP+ S+ D++HQAGR IYS Sbjct: 32 NVTKHFSFYNFSFSNNPRLVHDVKLLGSAKFSNEKGALQIPNESE--DIRHQAGRGIYSF 89 Query: 123 PIRLLDPLTHSPASFDTTFSFQI 55 PIRLLDP T +PASF TTFSFQ+ Sbjct: 90 PIRLLDPSTKTPASFQTTFSFQM 112 >ref|XP_003615494.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula] gi|355516829|gb|AES98452.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula] Length = 672 Score = 115 bits (289), Expect = 3e-24 Identities = 54/83 (65%), Positives = 66/83 (79%) Frame = -2 Query: 303 NVTKSISFQNFHLRTNPRISHDVKLLGSAKFSNENGSIQIPDPSQTIDLKHQAGRAIYSS 124 NVTK SF +F N R+ HDVKLLGSAKFS+E GS+QIP+ S+ D++HQAGR +YS Sbjct: 28 NVTKHFSFHDFSFTNNSRLVHDVKLLGSAKFSDEKGSLQIPNESEETDIRHQAGRGLYSF 87 Query: 123 PIRLLDPLTHSPASFDTTFSFQI 55 PIRLLDP+T +PASF TTFSFQ+ Sbjct: 88 PIRLLDPITKTPASFQTTFSFQL 110 >ref|XP_003519228.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] Length = 674 Score = 114 bits (286), Expect = 6e-24 Identities = 56/83 (67%), Positives = 66/83 (79%) Frame = -2 Query: 303 NVTKSISFQNFHLRTNPRISHDVKLLGSAKFSNENGSIQIPDPSQTIDLKHQAGRAIYSS 124 NVTK SF NF NPR+ HD+KLLGSAKFSNE G++QIP+ S+ D++HQAGR IYS Sbjct: 32 NVTKHFSFYNFSFSNNPRLVHDMKLLGSAKFSNEKGALQIPNESEE-DIRHQAGRGIYSF 90 Query: 123 PIRLLDPLTHSPASFDTTFSFQI 55 PIRLLDP T +PASF TTFSFQ+ Sbjct: 91 PIRLLDPSTKTPASFQTTFSFQM 113 >ref|XP_002270021.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Length = 671 Score = 110 bits (275), Expect = 1e-22 Identities = 54/82 (65%), Positives = 66/82 (80%) Frame = -2 Query: 303 NVTKSISFQNFHLRTNPRISHDVKLLGSAKFSNENGSIQIPDPSQTIDLKHQAGRAIYSS 124 NV+K +SF +F +NP + DVKLLGSAKFS++ S+QIPD SQ +DL+HQAGRAIYS+ Sbjct: 43 NVSKHLSFPDFS-SSNPSVYQDVKLLGSAKFSDDKASLQIPDASQAVDLRHQAGRAIYSA 101 Query: 123 PIRLLDPLTHSPASFDTTFSFQ 58 PIRL DP T +PASF TTFSFQ Sbjct: 102 PIRLFDPPTQTPASFQTTFSFQ 123