BLASTX nr result
ID: Coptis25_contig00028523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028523 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulga... 55 6e-06 >emb|CCA66222.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1383 Score = 55.1 bits (131), Expect = 6e-06 Identities = 23/79 (29%), Positives = 40/79 (50%) Frame = +3 Query: 63 NILIHCSFSWEIWSHFXXXXXXXXXXXXXXKDLLVSWALRVHSPKGCKLWNILPFAIMWA 242 ++L+HC FSW++W+ + K+ W + K+W+ + F I+W+ Sbjct: 1102 HLLLHCEFSWKLWTWWLNIWGYSWAFPKSIKNAFAQWQIYGRGAFFKKIWHAIFFIIIWS 1161 Query: 243 LWLERNRRHFDGCVTSMAE 299 LW ERN R F+ +S+ E Sbjct: 1162 LWKERNSRIFNNSNSSLEE 1180