BLASTX nr result
ID: Coptis25_contig00028517
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028517 (358 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] 57 2e-06 ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabi... 55 6e-06 >gb|AAM63520.1| DnaJ protein, putative [Arabidopsis thaliana] Length = 126 Score = 56.6 bits (135), Expect = 2e-06 Identities = 32/62 (51%), Positives = 38/62 (61%) Frame = -1 Query: 316 QFHPDVIKGDNVNEKKETFKEIKSAYESLMEKFEVEEELLTTDGXXXXXXXXXWMGFEGG 137 ++HPDV KG + + FKEIKSAYE LM+KFE EEE + WMGFEGG Sbjct: 65 KYHPDVHKGQD-----KDFKEIKSAYECLMQKFEKEEEEMEITEMGEIDEWEEWMGFEGG 119 Query: 136 IP 131 IP Sbjct: 120 IP 121 >ref|NP_565034.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] gi|332197149|gb|AEE35270.1| chaperone DnaJ-domain containing protein [Arabidopsis thaliana] Length = 126 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/62 (50%), Positives = 38/62 (61%) Frame = -1 Query: 316 QFHPDVIKGDNVNEKKETFKEIKSAYESLMEKFEVEEELLTTDGXXXXXXXXXWMGFEGG 137 ++HPDV KG + + FKEIKSAYE LM+KF+ EEE + WMGFEGG Sbjct: 65 KYHPDVHKGQD-----KDFKEIKSAYECLMQKFKKEEEEMEITEMGEIDEWEEWMGFEGG 119 Query: 136 IP 131 IP Sbjct: 120 IP 121