BLASTX nr result
ID: Coptis25_contig00028364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028364 (218 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|2... 100 1e-19 ref|XP_002530980.1| conserved hypothetical protein [Ricinus comm... 99 3e-19 ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus c... 93 3e-17 ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|2... 92 4e-17 >ref|XP_002306375.1| predicted protein [Populus trichocarpa] gi|222855824|gb|EEE93371.1| predicted protein [Populus trichocarpa] Length = 773 Score = 100 bits (249), Expect = 1e-19 Identities = 45/66 (68%), Positives = 54/66 (81%) Frame = -2 Query: 217 PFQGILYRVVKSNLVLAEFGEDFHRQHSSTRRYDVSLSFNRVCLKCCHQAVASATDPLFH 38 P+QG++YRVV+S +VL EFGEDF QH STR YDVS SFNRVCLK HQA+ +A+DP F Sbjct: 442 PYQGVIYRVVRSTIVLVEFGEDFLLQHHSTREYDVSFSFNRVCLKRAHQAIEAASDPSFK 501 Query: 37 NFLFPS 20 NFLFP+ Sbjct: 502 NFLFPN 507 >ref|XP_002530980.1| conserved hypothetical protein [Ricinus communis] gi|223529456|gb|EEF31415.1| conserved hypothetical protein [Ricinus communis] Length = 710 Score = 99.4 bits (246), Expect = 3e-19 Identities = 44/66 (66%), Positives = 53/66 (80%) Frame = -2 Query: 217 PFQGILYRVVKSNLVLAEFGEDFHRQHSSTRRYDVSLSFNRVCLKCCHQAVASATDPLFH 38 PFQGI+YRV +S VL EFGEDFH QH S ++YDVS SFNRVCL+ HQA+ +A+DP F Sbjct: 387 PFQGIIYRVQRSTTVLVEFGEDFHAQHCSFQKYDVSFSFNRVCLRRAHQAIEAASDPSFE 446 Query: 37 NFLFPS 20 NF+FPS Sbjct: 447 NFIFPS 452 >ref|XP_002534631.1| hypothetical protein RCOM_0173910 [Ricinus communis] gi|223524877|gb|EEF27754.1| hypothetical protein RCOM_0173910 [Ricinus communis] Length = 171 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/69 (60%), Positives = 52/69 (75%) Frame = -2 Query: 214 FQGILYRVVKSNLVLAEFGEDFHRQHSSTRRYDVSLSFNRVCLKCCHQAVASATDPLFHN 35 FQGI+YRV +S +L EFGEDFH QH + +YDVS SFNRVCLK HQAV +A+DP F + Sbjct: 76 FQGIIYRVERSTTILVEFGEDFHAQHYPSMKYDVSFSFNRVCLKRAHQAVEAASDPSFES 135 Query: 34 FLFPSQKSR 8 ++FP SR Sbjct: 136 YIFPCWGSR 144 >ref|XP_002310063.1| predicted protein [Populus trichocarpa] gi|222852966|gb|EEE90513.1| predicted protein [Populus trichocarpa] Length = 687 Score = 92.0 bits (227), Expect = 4e-17 Identities = 43/70 (61%), Positives = 53/70 (75%) Frame = -2 Query: 217 PFQGILYRVVKSNLVLAEFGEDFHRQHSSTRRYDVSLSFNRVCLKCCHQAVASATDPLFH 38 P QGI+YRV +S V+ EFG+DF QH STR+YDVS SFNRVCLK H A+ +A+DPLF Sbjct: 360 PCQGIIYRVERSTRVVVEFGKDFLLQHHSTRKYDVSFSFNRVCLKRAHHAIEAASDPLFK 419 Query: 37 NFLFPSQKSR 8 +FLFP S+ Sbjct: 420 SFLFPDGVSK 429