BLASTX nr result
ID: Coptis25_contig00028014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00028014 (306 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274435.2| PREDICTED: G-type lectin S-receptor-like ser... 59 5e-07 >ref|XP_002274435.2| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130-like [Vitis vinifera] Length = 808 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -1 Query: 156 QSCLFFLVMFFFS-SIQTHLCFAADTISSGQSLIPNQTLISKGGKYELGFFTP 1 ++C F V+ FS S + HLC +DTI GQSL NQT+ S GG +ELGFFTP Sbjct: 2 KACFFLPVLLLFSLSFKAHLCRGSDTIFPGQSLSGNQTIRSDGGTFELGFFTP 54