BLASTX nr result
ID: Coptis25_contig00027493
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00027493 (317 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632975.1| PREDICTED: probable peptide/nitrate transpor... 97 1e-18 emb|CBI30755.3| unnamed protein product [Vitis vinifera] 97 1e-18 ref|XP_002522283.1| nitrate transporter, putative [Ricinus commu... 97 1e-18 ref|XP_003532772.1| PREDICTED: probable peptide/nitrate transpor... 92 6e-17 ref|XP_003629869.1| Nitrate/chlorate transporter [Medicago trunc... 91 8e-17 >ref|XP_003632975.1| PREDICTED: probable peptide/nitrate transporter At1g27040-like [Vitis vinifera] Length = 597 Score = 97.1 bits (240), Expect = 1e-18 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 315 VNSATKNLTSSKGWLAGNNINKNHVNLFYWLLSLLSMINFFNYLFWAKRYKYRHAQVQVQ 136 VN ATK +T S GWLAGNNIN+NH+NLFYWLLS+LS+INFF YLF AKRYKYR Q V Sbjct: 525 VNRATKGITRSGGWLAGNNINRNHLNLFYWLLSILSVINFFVYLFVAKRYKYR-PQALVA 583 Query: 135 PVDANETN 112 P+ ANE N Sbjct: 584 PI-ANEEN 590 >emb|CBI30755.3| unnamed protein product [Vitis vinifera] Length = 1252 Score = 97.1 bits (240), Expect = 1e-18 Identities = 49/68 (72%), Positives = 55/68 (80%) Frame = -3 Query: 315 VNSATKNLTSSKGWLAGNNINKNHVNLFYWLLSLLSMINFFNYLFWAKRYKYRHAQVQVQ 136 VN ATK +T S GWLAGNNIN+NH+NLFYWLLS+LS+INFF YLF AKRYKYR Q V Sbjct: 1180 VNRATKGITRSGGWLAGNNINRNHLNLFYWLLSILSVINFFVYLFVAKRYKYR-PQALVA 1238 Query: 135 PVDANETN 112 P+ ANE N Sbjct: 1239 PI-ANEEN 1245 >ref|XP_002522283.1| nitrate transporter, putative [Ricinus communis] gi|223538536|gb|EEF40141.1| nitrate transporter, putative [Ricinus communis] Length = 587 Score = 97.1 bits (240), Expect = 1e-18 Identities = 47/68 (69%), Positives = 55/68 (80%) Frame = -3 Query: 315 VNSATKNLTSSKGWLAGNNINKNHVNLFYWLLSLLSMINFFNYLFWAKRYKYRHAQVQVQ 136 VNSATK++T S GWLAGNNIN+NH+NLFYWLLS LS INF YLF AKRYKYR Q+ Sbjct: 521 VNSATKDITRSGGWLAGNNINRNHLNLFYWLLSALSFINFCTYLFVAKRYKYR---PQII 577 Query: 135 PVDANETN 112 PVD++E + Sbjct: 578 PVDSDENS 585 >ref|XP_003532772.1| PREDICTED: probable peptide/nitrate transporter At1g59740-like [Glycine max] Length = 604 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -3 Query: 315 VNSATKNLTSSKGWLAGNNINKNHVNLFYWLLSLLSMINFFNYLFWAKRYKYR 157 VNSATKN+TSS GWLAGNNIN+NH+NLFY LS+LS+INFF YLF +KRYKYR Sbjct: 539 VNSATKNITSSGGWLAGNNINRNHLNLFYLFLSILSLINFFVYLFVSKRYKYR 591 >ref|XP_003629869.1| Nitrate/chlorate transporter [Medicago truncatula] gi|355523891|gb|AET04345.1| Nitrate/chlorate transporter [Medicago truncatula] Length = 602 Score = 91.3 bits (225), Expect = 8e-17 Identities = 44/64 (68%), Positives = 53/64 (82%) Frame = -3 Query: 315 VNSATKNLTSSKGWLAGNNINKNHVNLFYWLLSLLSMINFFNYLFWAKRYKYRHAQVQVQ 136 VNSATKN+T+S GWLAGNNIN+NH+NLFY LLSLLS+INFF YL +KRYKYR ++ Sbjct: 538 VNSATKNVTASGGWLAGNNINRNHLNLFYLLLSLLSLINFFVYLVVSKRYKYRPQGHAIK 597 Query: 135 PVDA 124 VD+ Sbjct: 598 GVDS 601